ELF(04l#4 (&#p  44K 4e(GNU-MЍ$  --0-ȴܐ0 0Q/@-(@0S0S 3/00h -<0MS 003/,0S 0S 3/Ѝ l̏p@-A0`SpփPP! ]C;]P 0S8 b]0(]p@\]( ] X]]( ~b xbꈐ}}ĨP@- H@P80   @Py0  ȑd)-MwЍQ@- @*0 0 舐@0@-@T[,0-S0rS\p3L}@-L,h@0-S0S0rS <\P0Y,Y(Y$Y00L}(}}F@PMs40 R@Ds0 R -M80000 ,0 0Ѝ G-QP8 i, 0c  _e%2 R @U  R NT%a GM%QB p@0pQ@ sRp0R 0R 0R 0R\"00\X [D>P@@0-S ];>P00   |OY   | d GD @0o0~~~~~~L}~0@-8@0M,P0D 0  Ѝ0X0P@-0S@P0S@(O'@- MP 0@S$8LL 0b RM 0SJ h5 SPX1@TL 0S ~ Ѝ4!0Q; P; 0Q6;0 pP0` @P$ 0P[@`T d@0%@T |0  h0 X0L0 H%P(0$%0)@-M @P q0DS8L`` l0?b[ [H Ѝ 40  0 00 )E-MP[Z`P{$CgNz[ZNPY 0pU NPO 0@K NP 0H "OP% 0Vpx p@P PwN 0F z*2 @]2 R   j*Q @M1 RCNЍ@pP ᷵U 7+@ ᭵M@pT*@P@ bT~Z'P ~b~`P M `P ]@ G90@0q@`@ PAP0: S Pb 0$Gb+ ,8ȑ@XD@-@0Sx0)0S d0 R X0X @ H0j0)0S0$ @@ ȑ+E-QM`@61P@pH.q,@Tp0hP@& 0S [pZ"0P]Z0Y 0R  a)P5 > ZP >.0 0> 0 0? PQ1@P?A/t>l.?d~ddn\.`?P@@@@@ < 0@-S00 . >  >.P>.PP>.@@ ?-@@=-@@=.@@=-@@@=-x>@EL=0LP$ PH=@ T  v(0-0-S  =0 sR PmP=T\@P@ XLkYXQ 0S6,< i0qS<6 P3 0-S00 -S& <Q P`@<@Q 0SXPT\20 R0  p!R< 0 <"R 0pSp;q@T; R|;a 0S;` " QU pTP QU -P00-P+P S`@ @T -T0S:a R*000:P: R:   : <: RH: R 1 @:P101 : +D: R 8: + ; +9 R : R9 R : R : R@9  -Q&PK9@ RʸIpK9 9 H: R I6C0S : R%9$)Q9 R8 RXi_qhl9 Rw8 RsD8 R# ^ox9 Rp(1 1 P 0@S!0  00!9!@!TdP`P8@7H8!R0P0kh7Pg(8`Q\8 RX7 RP8 R<70S 88-z*P 7 R6 Ri 8Qp7 R 6 R 6 R:6 R Px7  Q ph7 R L7 RN 7 R &0@T@9Uix&0006 R3U6 R5%Q" @6\E0SM  06 6Rl%00p6MD0D/S{ꌝ8 ؝X.   ^4<Q(4 Rv4 Rhf`4 R^ Z3 R z-S0S0S0Z ğ 0S3 0 `p 3 @]gp f ^4  Qr q P`2 2  3 R 0VTPP 0eSf #000JT@P3@ SX2P tR$ 2 Q 2   eKi-g2 | "1 10 sR% hR uR 0S"0000 P 0A RI1L&P2I&1@ RI 0-S00 000X1 R51P 1 R- 1.,PP' 1(,JP-@00/0x''''''Бԑ (+@ LD)+@)$+H)L)$<@P܀ $',@ }T}4D̑X'ȑ)thD2p0 R'd0 R#0 R 00S0MS},@@(T'%P0S 000=PPD109UU1Q t1 R!00S0SH0S0dSTP 1 R1  Q  -Wo2 R$Z(2V8Tp3HMP2 R ,FP<APL<\ -WC1 R 2 RM 2 R2+2 02 R 1S3 RM 3 R<,#00,3D3'٬#P {t\1 3 3P3P.*1b101 U\5r4 R4 R fuf-M :E7㦥40@-P0M0c0 R 0 R 9RP |0 R p 000@S Ѝ0D#RP 80 4(N`)d)`'T)p |tE- M50@S1@`p0S50 R/0PP0@S00 S W|ЍGP P`p  PPp`Hڤ`|p'T)`0@-M 0 02  RX@Ijx2 RT T2 DRxЪxx 40Z(2 2R X}P^1PU1 Rl0 0 R !0001! 40S*1 R, 0S /0 0t1 R81  ,1 R 1L  B Ѝ041 R$1 0 0S k0 R 0 @0T  00 0 Rd0 B Px)t 0S / @4@H0P/P0$ +()(+>/0 R/d)-0M Ѝd)$ R/0Q0B0/( 0S/P00/d)0 A A/d)40 R R 0S//$P/ 0 0 0 /00 R $0S0C0/ 0/HDx00{S CS 0S$#0`0BM@ N`:`gYY@  ) y\00   000CS000CS000CSPBM@}^t^dWR tWX TW @W_ AWe Y0* 0N|sM@`0`{SBM@X^O^PMf0@S}S  00S}S``0 S%0X p0  0` h@Y:0`S0S"  )`@DM1)MhW@.LP``0P0~!vW@ d4d 0\<`oP%KP @@D8$:N,0WW0 d 4L0S0S (`@O3`VP4[W0   0000@`08aW0@0 eW00 rW 00p0`0%^N`@ 3+#0PC C@KML`@ @0`S 0 00 0R  0 2`#@,ML@5 0Pb 5 \P00[0S P%0s Ѝœş0S 0 0-傜X%00\P00[0S 0%0 RQ$5  0RS 5 R %00CS-$Ԕ000$弔0000S0S$0 S4 4 R |40ASt$0S T4 RH4Q P0@S0ST 0 Rjtr 0 T@PPE  000#003P#0S+ @T+ 0Sz 3S R 00 S'R00 6@T ,> 3T@z ;K(3P#00C0@To2 2R  ~ "00CSy0Sx h2Ǜ0Su "0 S\2 t\\"y<R0Vt("0S5 U2 @00(2L l!0S 1喛0Si śg0ASY\!U1 Rڤ1 R 00 SR P 0;S wl1 D1@P1 R 0S 0s (1  0s 0 0S0 00 #x 0Pd@0S\ 0sQp m40 DH(@d) T)t,@2\)4 cO-DMh'P 0 "PX   0 "PP h0 000@90 @@p(0 $ `V2 U P0S# @$0# pP  P. \ Q #UA $0S. U00 S T0`$`D$S \ ` DЍ@pV U0 8 R |(00CSmUUX8QL8  0RS 0S 0` 0 P@pS ' U  0 [00S U{[ U 7Pdڠ7  0RS^h 0" t7Qh7  0RS`V'[ \U [ $7!e 'Q7  0RS[ F0S0 4040'U0X0l ƟQڐ6  0RSb 0 <0,0\&,0C^0~ X @6 R &Q6  0RS < 80 B,'@,00SN 80,@<0`F<0S 0W,H<0`,Q <$Ud5QP5  0R0S00@pV o'[ sh\U00 4Q4  0RS  $ 000U0SUU 4Qڀ4  0RS 0 0@`$ P@pS 5T 00S S S S4Q  ծ3  0R0S00 U 3Qڬ3  0RS 00C0  "R`U1p3Qd3  0RS' ` 0<0<,8#,^ <0S` 0WX@pS P2Q$2  0R0S0$00 `R00SE (U{U 0q l2Q`2  0RS3 ^APq\}[U ] 0Q 40"U00S 1 RJ Qڸ1  0RS < (08 B,@,n8 d$,;80`F0<0@pS@pS ;4  (N 1 0 <0, 00Vt[U0\y$,:,G`F<0 () <0,C :,00{} <0t,6 d)@,ܑG-M 0@ () \41pP& |)PP 1Q 1  0RS T`+ @"PP  B>H 0P W` :Ѝ (0@0 ` B%H 0)  0P 00  BH 00@C@O-!0MS1  !00CSl1 R 0S^`q封0S30S.PP u@  0R Z h0P` U00Ѝ0R,A0Z\U00Y0S 0P`0ʗ P 00000P `0SV PP0 R\0V0 00CSroP)d)PT p@-4P0Sp(`@0@0CS0p`)\O-PDM PDЍ,nPU E?E0CS00< S_ yp Ο01 #P P" B d`=L.QT>  0RS2 <X@@>XPP000090MXp@;X &X (X X)X| (X < R>X<X(W Qڐ=  0RS P-X ̟0S00H Sx $i` \T,p00pS\XQ x  1 ,Q<  0RS ;[ 0SN0`X @@ 80@˟+0P0CP0 80 0 0S`+@|E80"X 0U00  8 X= $ r3*Q  :  0R' S pb $0S 00H S 0$X0XXʟ0 0000$0$*0 R<Rxʟ0l X`: R$0s3,S0:(ʟ 9 R *X@X) ?X+X& !X$ $X@@$X<X >X [``[X00S ɟX9P 0P P 00 0F =X00S 98P 0P} {Pz xɟv)=0@Pp`000(P`pX ɟQ(9  0RS (P "t 1] (Q8  0RSS @ @ P P P p8Q|8  0RS 80[] 7PP 80 0 0S2'@uD80U 7l'00CS$|3'Qڨ7  0RS P@) `WW 0?"WPƟ1#3 $ (PP [P{PT 6Q6  0RS {U\ (UƟ 0S @p0P80) E0`0C05Vt 80 0 0S%0@PC80V00 v7,Sl5dş T:(P@%Qڜ5  0RS} 4T 0S0@) 800p$0CP`0" ğ80 0 0S$(0 @0CV80: $75,S(4 ğ $XH $U00S7 D4QP4  0RS- $ 0ß  00 R@ #pC600<RP#Hß0J8 J 005'Upp'U"UQ(3  0RS H"Db0" S0 P80@@U!0P0CP0 W8 40 B @6 4P6440 P!BU4@ x6 x1`Z00 >X<X!PU ڸ1  0RSԠ0Si Uڈ1  0RSa  @]@!jPX pQT P@QN 0SBP0  10@ Q<0P00o, "d`)Ld) ă !#|)@P7  0 Q00S T@l 1P 0P P0000S Qڤ0  0RSJPG00P1;B \000P000Q 1 0 0R)S090X!~P 0@1@02P 0P P 1 00p2P 0P P X"P 0 09042 $2A/BP2Q BPPRb`````@}ʚpPy 0v@aBP`A0 S R 00PVd   @k,3OPf sQb `P@QZ 0SAP  104$QH#DT00R0 } z04 4  cuV B$,AP[] 80`Y|$q3\Pz 4Pw t4PUh4  0RSw 5pW $0S 0C0 eR h7APxU0004 V5W T@TEW 00 M 0]SJ0]SG0SD^ 00 H5 RQڔ5  0RS 400>0H&26 RR(&Q6  0RS -P&0S00ը6c {\0S6 7 P 6Qڨ6  0RS 07pH'`6*|7 p@0@@r)P P E?@0CS87;@c)P|WP 47 7*T c T7` 0S @W`V 0S 0 9008P(0(= V PH ]@88  )00300 9 R7,02,S49< )L,Pd9l |/8  B40c@3?P3@4 00 eR6 lR 0R 0R 0R 0R)090 Qp PcJ: R 4* P0900,P: po@a: R! *00CS} 80`0;0K  D;*Q+\[0<0x 00 `; Rf ;Q @ 㟸GP_dP {P\0SY+P000Q<,QQBQ0 <Q- B?AS)0dS&0oS#0S C_70-S<0pS90S6\,P. }P+0S(0DP0 <  "0iS0nS0SP<  ] ]  >XW |XS <XG-PI_ <PP] X]\= J_ l=JP T MPx)000oS0S BP P7(h.Q >  0RS <> 0L^000\^`^G_l>P (P (0OR>F_ > F_ <P  P# <0 0(P(P0z&P Q<,?  0RS6 QX?  0RS>W Qڐ?  0RS|W00S Q?  0RS&X00S Q83  0RS $S5^30(SQ  z "Q2  0RSp Ÿ 00l2Qڠ2  0RS Ÿ00^ J@DEp2Q  `P T @4 E1P(2 0R!0"2 R㌏@ w1!Q!Qڔ1  0RS 1 1 1  1< 1 PX<00\Q\110PEU) @1UQ 81U00^ U 1U<0W {U }US!0S0C010PEUS 0U 000<08Pp ~P|<0 0 D|P\0qpPolPm@%T), |)'2"&@-P@G P<0 R 0 00CS8 P d)E-MdPP@B (P 4P% 0P|lt 0!S 'PP8 @@4PP,4 0 0@ 0Sr@P000 PP  @1 D0 Z#3@ Ѝ0 H3PP8C~ >U<U@@ GUU $3)UUppl0 2@P2P 0 0 |@YPӌpP x @ص ?DP04b 0)S0[@8@  'DP WPP7  㰵 D(01@0sPP*  @囵 D0l0P =Ru80Rq 0Rm 0R h yC @qCE<PP  @d C/` `0@ 3 @SC#d @KC |)<@p̄8@܅|@-(0@ GR 0@ @-,0, @Q 0@ -MЍ @- -ML0 M0?Ks/K H( B   (岠00CY.:T?QL D?(P0 @b0 c@1@qP   h?(A10 c!a ]? P0E0CY$*0Cx h np0XU x0s/ h> R  JR\>ZӗT>E(RH> R 8>0S 8CȠ$>pPU0e104 K0LS񟗢|T%h%D% %\8`@@ d@H4(,p\PD8, \d$$$X$($##D#""8""!!x!T!0!$!    | l \ P 8  ''t'`'L'8' ' ' (('''&%%&&&&&&T&4&& xT,pD(@`\ 0S ᩴK+1  ` 04 S0C0`+児I0X+60C@0;!H\40KC$;+ 8CȰZ |l18Sq (R: (HR" 0q00XE8 s  :R: R* 8CJR p:P  h: (K p 0`8 : R: 0S  B I0SP H0 SS8: R 9R 9 R0S )00CSI p9 C)0@ 00R 9\ 0S 0 Q(8 B ( D8  x 4 G8  o 4 >8  g 4 68  ^ 4 -d(@  XhX( 1 | 04 S0C0(@`\ 0S ᭳G'1  d 04 S0C0(@z  g' 1 Q 04 S0C0l @g  `g`' 1 > 04 S0C0  @T } g' 1 + 04 S0C0F&81  04 S0C0ŻQ0 000040 R0000040 040 P6  4 =40 040 5%040 5P5PP %0S5P R e%0S@5 T5r3D% 05 D5  8ş,5 4 S5 { 4 J4 r 4 A4  i 4 84 ` 4 /x4 W 4 &T4 N 4 04 E 4  4 < 4 | o 4  < 8 <0K 4  000 Rd3 Q0 0000040 Q0 0000040 83  4 3  4 2  4 040 040 040 040 040 040 040 4 4 040 040 040 H R0 0 0S00040 040 4 0 40 0 1   4 v1   4 mp1  4 dL1  4 [(1  4 R4 M4 H H0S00 4 <040 90 00 4 40 40 0 /X))''RY|B\v0.|)x)d)<8`܆d\`) Ԇb 4 4 h0   4 0   4 0  0 4 040 ; 74 0S  & .4 0!(4  4  4 040 f4 4  4 ( 4  4 4 000H R0 0 0S00040 }040 zp2p 0t4 q2 0k4 h2 0b4 _B2 !u04 S0C0RC3(!h04 S0C0E4C43 ![04 S0C08(@`\ 0S ˰C#1  v04 S0C0 (@`\ 0S ᳰC#1  ^04 S0C00(@ S /S 0S !  //᜘Q0 S S  0 S S  R//P 0S /S .S /0S/S .S0S/S//E-QM0SD palq00]P@40 @ PU T 0 S QЍ-Ƞ0S 1S  T PP000TT!0A0\0@0 0 @-pM@PT P0  Ѝ|`0S PZ@@P H0 0Q0 UnU@0@-x M0@S 0S XP0S P@0 1 S RЍ0Gꈐ@-  0RM  Ѝ @p`0P0Pp` p0p `P T@T0T P 80P@2t 8<0@G-鴀p@T P0  茠0S Pڻ 0S ``P0@`A0SP@W0W@p@-P0Q`00@ Q 0 0~S k`p 0 /SS :S 'S \S "S2y1(0( 0 <@E-0@S/S`Mp 'S\S "S 'S\S "S Q :S 0S/S`dH Pr2W0 0` 1;31W0P0Ѝ@- +R -R 00B S R@T 1!@1-R+R 0S8%/@0S /@000C Sp 0@-@PMPЍ01P@Q0 0:S0S:S 0 0 S:SQ  Ѝ0@趭0S000@0p@-Px.`P X1P@  1`P0/SS p(@( 1 DP~00Dop舃Q@-@ 0/S  @-1@00@-0M~S@ !10P0/S  @#PЍ0P@-0@/S /1P@0S-/MPЍ-lM VP0: SlЍ@-@Pp3-M Ѝ@- @ P +@E-R M@B`%PZP p@DT``  ЧpX00S@ Ѝp@ Z̪P P@`@@T``0WP ߦ -HMD哦PЍӦ,0DIP 冦Ѝ0@-PPM @TЍ0§ 0#5_T0 Q 01_Q001_R0  R00@-M@Pᜧ 0#5_\0[0\0U0S-\+ =\) [\ 001_\0 0\ =\ [\ +\0 =R Ɏ0]S0+S =S Ѝ00 =R0@-0M@PP X Hk7Ѝ0UnPP 8[7 p@-`QMP0@ž00@ -0S0 R R00 R R U 0S RV000Ѝp@-M`00f@Pp 0a00 fZ0@P0W  Ѝ@p@-PRM`@ T 0R Ѝp 0R` `0R 0!d d0RhP 㻤P  ᴤP @ @0@- MR@ `05Ѝ0PP 0S %P P 0S  t@-㏾@㌾00     @-@y 0T @000 0@-pMP@`f 0@00 P`Ѝ 0@-PMV@ S,0 P  Ѝ0 p@-P`@U@ 0S ῩP0` 00p0@-PM@+ @ P Ѝ0@-@0 @p@-` @P08p@  p@-`@P0H@ Pp@@-PMp@0W`8 0S mp pЍ@@-@۽@ @A-@`pPν00@p P`A- M0 0 Ѝ- M0 0 Ѝp@-`P@ᦽ @`Pp@m0@-@MP 0 Ѝ0@ 0;S00S 0;S 0S 0;S0 P0Ѝ0P0@-<M0PS@ 0C00Ѝ0]p@-`RM@P U @ЍpT 0S0 0 @`-<M0S 0C0000Ѝ(0@-M",0  0S4 ,`[@[0   1 LPPZ0 02  0Ѝ0#W@@T X  0S T@ T  ,P0 S ,P0 S 000Ț 4 G-@M@ @pq,PY0$S000 "S @P@0 e40S `PPPY Ѝ'S `S000Pp@-@r`PV 6,⤻+p㝻`p@-@@-0PMЍ0S 07200ЍO-0p M`0 S S S;S00@P @0S;SPP!* `9P`V V VU PU pV=Z@ / W0 X p1 0 0 ЍOVʠ  2 0 2h0 Ѝ L  r28s(opkD)$- M00W ЍPp@-`Pp@ P  5/@Tp@ Dg L 000/,00@-xPM@T h0h PЍ0000场?0$ ?00屺 0@ ($-E-M8@<002+0T0` 0S] 圁p%Sp 0@P`0 /000W 0S 00ЍEЍ/@T dTp$ %T cT  e^1sT0P00*`U`@T00S `0 00 00P0  0P`P`*@$$@ WP` (`\,0Q 0  0R S&S/t( @-@00S S S# S' S-] 0YW@0 Q0SL@GpC@\=@ 047$5@S 0 @,@`f@-@!@ꤛ@-@ @p@`80 ꬛0@-@ @긛@`0@-@ @ț@`0@- M0@SpPT  00 R 00Ѝ0@0TP0]@-@0,0T0S@,fp@- 0@P STRtRRRRSLSS TT T\S|SSSSSSSpQ @8p@Qu$p@p@Q p@`Qs0c1V u0 p@oQMOPD 0 _@`p@x p@YQ 8UXp@QQ M<p@I 0p@E $p@A p@= p@9 p@5 p@1 p@-`p@(p@$0p@X@HH0V@ <<2  |ԛܛ@@LT $,4<DA-PP @`TTp T0S' %PU @TT-V00P`ppU`VP@@@T00 0 0 @8@`@-(@z 0S @@`E-pPME V0S0C0" 0 R,WW,X `P TT apP h P Ę᝘Xh0#S @&*T~ЍHPPhpP 㫘@ᄘT P  ず)~ x)=z2@@1ll 000oP2P"L2P@@i h@Tp  @1 0@T0 B1 0D 1 0-S001 RDQ0Sa a0S@00@S|A00l1p1\i0!Sw 0 S S  R p!@0 S R$  W  )x~\+r1 0 S S S  Xt (~Dð^00AM ^0Cp 0XDD2)L''''l-Mq3hqЍ,h@-@P 00@-@ኧ@0@-pMP@ 㠘P#U᎗t t 㓘PT00T0SЍ0Ѝ0@xじPЍ0@@-T@Pj@[, _@ @|(ꄝO-鼡@S MPp1PF 001U+ 1U( |1U$ pq@t@30S00S P1U9 5/0`S00S 1U7 0S 0 005n ЍT/ `Q @T 7n00'n 1n Sn00@d0 R d$n`n<0 R <n,nnplĝԝ-,0 PMq000Ѝ@-MPl^`P< 1 R6 0 0A2gP h0 PR U00@PЍpP @* ☯hX0 PR0/@P7U00@P8p$+(+ G- 0RMP\ Re Rk Rn R 00=P; =R @N 0 a0pP pa2`P `R1Z  I@PW V X @t@3Ѝ 0AP 0tP@p@3Q =R!R=R@ 0`@p3~P% @@P @@P0 %a0`P∐ `|R 0[r0@p@3V0S @  00%?p뼟80@-@MɮTP@@Ѝ0΅ ##p@-0PMP` @ll 0@PXlX0 R L0S@0 R pЍpo<5pO-!`0  00 0M 0p00pqp30XS@) T00S*ZT' (A0S0Q0S20S30S5 R 0S 0CS00@S[2T00S R x0 B d 00C0ЍXPgo0S oh0S [o0S oO-DM P@DЍ 9  (8  G8 RAreP8 R XP eHw+g(0SP@@@ l 0`0 0  u\b 0 r 3SP4 S 1 ǟkk `0 000 ǟ007 PR'0S{0P 0SA0|ǟ|00P 0S3PX'QTǟ00, @P 0S 0S@UPT 0P 0S@UPTP,P4 Q ( 40cS(4P( 64 R0(0p64\00(0Vp Pi(0, 0$0P $PPP4 R! 4ᒁ4@Q@40Y YcY Y5Yڠ5Y`0` X(P PVp @ @`V @T0DşD04ş 0P 0S 0S 0S4` Q0$ 0pW g$ L$0SDğ0S+P P0Sv 8P 80T4/T Q  08< 00@@ P8< 0@`0PST0ST #\3 0S @3@ Ry 0Ss2 Rm#0S#0S 0CS0iqP` 0`s`3  04 Q`e00dŸ`  Vm 0`,42@PU Ÿ  1@᐀@paI>! pAmZmz1 @mNOmGY:`0`SSAsumz?mspm:m0@ 00C00aj0@80<@SS7@Q0C0J 0 R0 R DXiL 0@0C000  /m( 8/+ 8i$' ,jܳ@)O-$M P =P 3 R 2 R @Ѝ0 0 0(Zii0 000 R@b 倢倲`-0S30 0`2 T0SZAbP82 R ,rP BLDd0@SP `V/ 0S 1vl0S l0 11 0S.j@1@ R% 0S0SL!0S8@!0S 0CS0 00C0 00xiupl09l/ |0 Rh0 R 0  TlWHh<@00C0O0C0X P0 Bl 8i(8/+ $+@)O-@ MP|\`8 &\] ;\3  0!lG?LSQ| R000p0S3 R GRW t3R  W R/ Z  R000p$Z  R000P000B0SAr0S;00S20S-0  0pЍ@T Zx P̌̎0p ;00P Z0 00kikkdk00 0wp0SpE P0SC @ו0  l7hh/h`,hVP'hD $hZ  R000 0  @CVڐ `אg0PU 0S0S 0|S ؑP!0@@9kppZ000  0 Vpc᫐`&k!jL +4p\o@ )O-PDM`pPH 0SD0S@? R<t0S=h0S7c@T? $100R00S@,ϟ@ P* 2 r@f-@P V0u +V/ > RcDЍjj@ h 06 P  V 0h0 0uwV +Q p3`>P  R ϛ= PvMP   ^00\MP S00  $g R  g0S g0 10R0O̟0SI R ꌙ`ܙdPȖ 0@Q 㠟 R  0S $ f\ @t@30 0CSp@bd,˟00K0˟S ,000p0 0 0000;  0$0;˟$R l; Rd+00c0440Si 0+@0\ 000;X+`P+: 8;Q8P : R*˟00c0:  }A_P zP J@8ap: RP@P*:@P80hʟ0aQ 0009P)9 (*Q 9 R)ʟ00c09  DA_P iP | IBa`9 RP@(V<9p R W0@40 0S /@4' 9 0PT` K @40S P@@VPQ  R000h 0 @ |ȟR 000P8  P80(08 R A_P7 R gP  G∧`'0SP ( @  R 000@Q 000S@H0 B80< ^P R P0000Ɵ 0 ;0@0@hƟ@80@0zx6 RuQ <0HVR (V 5 R 0" 0,T00S 0 L5 R x5 R5 R @6aph0ES 000`P 0009PPk0Sğ0SP 0000&@Q 000O@ 0T@ `rP@0S 4 R @h 0@ R 000)@B^PO M](Kh 0n`EC00=hl3gh 0w'0S 40S Pß0ST k0h00 0@{U@P -00,0d d ZI 0SxŸ0S`V;X"0S1`V4 MUpP P P 0S"40P0hhŸ 0R  S00 ln@ T0S 1TggePZ@@$ 491 P40`S. T1 R3 P) 0PS60S000@S'0 R! R R  B0R $0!0440 S@ 00C00)1gf,gf$ +`thp$+L(+ 8/`d6@t  d)7 PPH  @00SC  T x@,1P00S000@ ~c(0f0f0@|fm0fef0fL@1 P '@4@~^$@p&h!h1 ft1 B `E-p$M@ 0 P 0  P 0 hP 0 P 000D\-c5 D D cGcDcbAcc;c8c$00p A>\P@B9\PPC4\P`T 0`4 RD R A]U 84 RD0S B]V A-\P D\ C ]ß3  L3P@C o o@ ol3 R 4(#0H#00oPP= ,3,C`P]3P RDD RE Ÿ0 0C0&qp !q~pxCP 00 \ 2 R d2 R $Ѝ005  )0^ @r000@{]2` PR1 P1 R D RAb1 D5 50l1 RhbC}[P>1 a P\X 0L0 S6Qp1l\  E\R\@ U\b S\gSo0 @T _0S` 00p V 9@PT1@T@PT#J 0P``jSo $00 [;?2c"  l!So @T@PTSo0| 0&}:D c`'Q//0 0 /ᄔ0/  /0P/000 S / 0S //  (00 S/ 0S/ 0P/ 0  /0@-40@M1PP "PЍ0p" 0R/ 0 0R/ | t0@-Q MP 0S0@ $0 Ѝ0 CP 0@-Q MP 0S0@ $0 Ѝ0 +P \-0MCS RЍ5TЍpTP@-@M0`Sp P P@S@ʄP 00S$ 0Pt 10Ѝ p 0  00 |0@-@PM R 0@0SЍ0 0180@-dPM R T@0SЍ00C0兤 0h 01Ѝ0@胣8@-d`d0 0SMPpHp 00@P]# 0 1Ѝ84P@-@P @P P@70@-DPM0P @@0S 0 Ѝ0t@-@0 P  0R 0 8P@( ㋅@ ㆅ@Tl0@-@T\0@T  0SP 00zP- MQPЍ0Q /000@-QPM @@T P Ѝ0Q@-@p0 R d0P 0S3/<0 R 00Q P 0Sp2(+ 0 R0 Rp2,@-0@0P00r0 R n@`0@-x0PPMh0P    @T 0S 80Ѝ0@FP  㘚<8`-M0PЍh -MP 0 ЍЍv-MP0Ѝp-MЍ(0-M 00C0 Ѝ00@-@P0M  R0 0P P U HOO4Ѝ0@(O  rЍ0@0T4@-0@OyO000 @0p0 R/p@-M:P 0P 2P 0  h`P  P 0@VgЍpP0S gHg0@ RQ0S|E-@MP, 0( P" 0 T`p P`p0 )fP0`@pUm@  fЍEZ|@-@4P 0ST00::00 0@-PM š@ᾚ00P0Ѝ0O-PMA 0S> RQ009  R600X* [  0S 1/P  `VP@Pp@T !@0S f PX0 RЍQ0Q 0X 10:`Pp@-T`PP@pP ~@ 0@pQp@-`  0 S0RP @aP 0l@T@p@pp@-P`U@     0B00 0p0@-MPU@P 0,:000 0 @0@Ѝ00@-QM@P 0 00Ѝ0@ 0@-PMə@V ę 0000 000Ѝ0p@-H`P@P 40 P &9 ⧙ ppp@-XP`@T ( ▙ PP Pp㊙P@+p@-p`PU d@P X@PpMpZ40@P@@MMp@-`@D0P R  VN  /NPp@-@0 @.0@-0MPU 0  0S PU )MPЍ0PPP  T@8 0_PU ,@-@P 괿0@-@P hȿ괿O- M:P1 Ѝ 0(SD x!`V#y X1Pp@U@ P0S  P!0 20 S@0 0BV& 0R @P0 01 ' ╘ h u P  ↘ ~0 0 00 Р@-PRMp` P0e@\YuL0Ѝ0S0 0S0 K@B ԠO-P M: P# 0ܠP` 0AS$[@p 01` P Y|| 1`P ЍO 000 Ѝ O-PM 0S:`P2 0S/ ATP  [Pp @ 0R( pP [@\ʗ0p P !007Ѝ0S 0S >  P@0@- L@P@P @-@P0P P 0$0  @$dp@-QMP- @@T(  K`P pW ,!000  !0S LD@Ѝ&P 0  R  * PP P P Kp^dp0`0@- qK@P@DP 0, 000`ljpA-@?Pr0`=S@J LB0S~ lPP} P FX| 0"60P0 800IpP0ౖ@=000S06!00@0IS9 x1 R"0S0 0S0 pp @0+SpqP) 10S$ 6 0)g 00@0IS0FS0SS0S5#-*|J|PJ00|p8@@-M`pPP ^Ѝ@ @ P @P'0 JPЍ@-M`pPP# P 00P V`  0 0R :0\0  TЍ,0 J@Pp,0@- u@Ta000O-,M P 0 Y 0  PpP`0  00 a0 Pp@` W,Ѝ /S, \PT' =bp pP` 00 a0P@`p0 @ TD T<p p` 0P@pR 0 S pP` ʿ 10  0 0 ia0P 0p@`W0S$MbSSꨂ 0Lt@-MP`p@P Ѝ0W0 P0`0P/0/ 0_A-0M` P@ 0S Up@Ѝ@0pSIVQ@ PU _͔@ǔ@P0PPP0Sp@ 0S 0Sp@P 0S 0S ࣔ@*'0:\p@-0@`%  0^4 ^00 0 ( ,0 001 Ѝ0c^/^ 0Ϡl  A@1@@d_0 0 0d0 0 d00 0 Yx00 PH0/A!b000 0c00 0 ppQxgfff@-@P舐O-LMp `V P0S =S0U=Sd p `V:  *  0S   ԩ   9 0S 9 9R 0008 0 00lIɽ d Tv0 SP9  Hi0/S .Sh @P +P< ]5 @P V R8`pP.@P00 0`Z 0@Z81@  0 0ZT8 0 0Z, 0Z 0Z8  Q   RP 0 4W0S `7 7R@F7 S0S=` 0@X*PWP 0P  0@$P; PP gP0@ 6&0  6@ 0@ 6& 0  0&006 0 |0t&00l6 0 \0T&00 @ <868&8V0 0,,&,( 9  : : : :P LЍ0fS 0[05 R M0 900|5@ =0T0~ 0{+♍ps0(S( uP @| 00v 0F P)R  @P 0 9004 0)S F0S(000/SXkpP @QPHD8 4 8443(P 0 a0S 0S "2 RG b0/S뀒PXtPA  PMp}8b<4P4 QN  E0":0 P4 000 000Py{PP/ 0Sꀟ}]@0P .R @P 4PPvx^0;l F F0(S 00* u/++ܡ4 0~( 8DPTXd,l(t\`d'xtL@)(  40T8@HH Xd|,8 $ppБ<ԑ@̢آE-pM0S Ѝ M 0SP` 0 KX0 @P`R@-@ 0 p@-@ΥPX`OYp`p0@-DPM0@S 00Ѝ00 R0mup0@-M@%ccPP TPЍ00@-M@ TPP EPЍ0@- @㝊0 R 0  (+-LM0P 0SЍ䘺 gP00?dO- M@1pW " @PU 1 ∋@@0S T  zr0pW0 !0 0 Ѝ0-PU 0 !U `P 0S0 0S0L@C=000S0 90 PA-餁0SQP q R 0 S0RT1TA0 S0DR0 0S+0 S1@ 0 @ PP W`nV  0T c0@T 000ap0XPP 5`LV  00p ȿL-(0M R HЍ~Ѝ@-@000@-PM㣊@ 0 P0  0 0P 00P Ѝ00@-@MナP 0S #H00S Ѝ0 g_/|0@-@PM PP@PT0S Ѝ0@uЍ00@-@PMP P@PTP 0S Ѝ0@uЍ0A-`P3 .p00 0 P0  0 S(T<TT| 0@ 00`@``@P0`0P7`Pډ0 @0  `@PÉ@`@ P幉0@0g0`0@@嫉0 0  @TP ``㚉PJ``@TV uP` P @僉0P0JG`Pz@t0P0;8 0S 1` PdP^0@0 0S 0` 0@O0@-@MP 0S  0 P 0  3+Ѝ0@-@)@0@-PM 0 @0 i Ѝ0P0 rD-p@-`M0 0F qp0 R  `@q%`8P @qU  ۼ thL`0@-Q80@PM q 0Ѝ0@Dt-0M R 0P 0SlЍ8PTP 0 P 0SP0P,+-@-M`Pᨥ1@ R81 R 0p 0R 0`v(0 $ 0弞 0 RЍ@ Ѝ/ 0RNPT0TpT QH00L `P$p 0J㥛@ -p@-`PM\ `4q@p .0 0t Ѝp@Ѝ/ 0@- M@YTP h0 R \0\ Ѝ0@ HP< 004 Q,,00  Ѝ0 @-p@-MgLP`0 03@  Ѝp@Ѝ/ X-@-M4@0 0 EЍ@Ѝ/ -@-M,@0 0 1 -@-ML@0 0 $0 RЍ@Ѝ/ @-@ p@갤@-@ p@Ȥ(0@-@ ~p @l@-@ g @!@]P_8@@@88@888888@8@@@@@@@@@@8@8888@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@8@8//@-`M0 CR |ptp0lP!`@ P r0!P k0 g0 CR 0Ѝ@]@-@@@-|0Mt0 @ R R0 S S L0QH @ ^ 0S$( 0@㴀H$+PXxO-PM 0S  0S S S SrpЍ0S ,0 S Ÿ0 SBt(㇆21p`1 P@0$0!0@p ` P b Z!0@ppT1\<p0S.? \ 01_Q0`@@[TP p (pP &77⥅'7'@p007000'`07@Px'0S =0S0 DR0L'SH74'0D04',7P@ 7 7 0 &0&00E S0 =R=U=R` !U00S`>U `<U00` <R00S  0=ST6  ` ` ((6 ` P0 1#U0_U@U 0QA 0A 0R  R #Pp  0_P  >?)@P> >P`Y> / 7 p@P #P Rs00@@T- m 00p000@0 S P`a0@0SW0@ P`A0@0S$Y0700c YP`t m>S8P- -4  4$4#@P]Q9 P 0  0]SQ P 0S'#3 R  ]RH 3 R sEh #@tmp03 0 03 ]A ,TS ]R0@` Q XQxQ4 `* T|2a S@T >R00 S 0=S 2  ` ` &U&R` |U|R` *U*R ` -U-U+UR* =R` PKl1K@T PT? $h10S9 \ lHP1`P `PE 0S [ R 0 R R R0 R0  _PK`Q``-U``| l@P R ? ?P`P`LPTX`ph\إ0`l 8@-$@0,S0,S TO-r M@0DS+T2@0DS -TPp` ЍT2@w0S @ flT,2  0@P2` R 00Y`P(T> 0DS CljP`ꘁT` D1Wx!00`1\!00@1T!0 0H1 , 0BS&R 0 00`  1 0 0r0P)S`  l' P vRl |0@h qD @0S80\00eTXdhp`LP-X0M0!S ~S Ѝ;ЍTE-M̠p0p0 S#0@P Q| k0 `P1"70P@`@ pЍTO-M `p0*S/S%S2t@P Y 7"`pX  0W`p%SX@ P H DkkZ  0W`pЍTĦA-dP`0-Spp+S@@0 -T P`W PU`TE-M될p@ 0DS TP` 0` 7 0UXQX%@p 0DSЍ@ `7B PAQ5pTA-P` >T0W Q0@* P`@0D<Tpp<TST TQ0@ 0@V0@UV0@UPPT@-MpP`@0DST TU0@ 0@`@P0DSЍU0@VVTp@-8`@0P&S}0@&SP pTp@-8`@0P^Sj0@$^SP% pTp@-8`@0P|SW0@|SP pTA-딀@0PSp000?00C0@  00 Q00@_0 ` )TXpA-똀@0PSp00000C0@P0 ZV0P@PS000 `TXpO-MS`0p?Sp 0 S@@ S=S)3 R  iT"_̀`pHL3@ R4 7 5P 13 Ѝ2@:⨀+T /T ]^T@ P! |TY@P`px2@ R &T@P N%Tw Tn T>6@ 0`C PWBQWPy0:SSH 0&A00000C00:S  Xi`1P* ` A`0 p00100C0X1 `%`p-T 0 2iY@P*TF!#P $iK iE@P@P@T P  0nU@PyP 0`6S PRQ@r  0]U@PhD h0 hTX`p\Ԧ$Ħp@-@Mb/GyP `P QPP L@@@ R0P`P`@ލp PR0`0b/x`HL0 R R R !R/0/᜔0 0 0 0 0 0x x0p p0h h0` `0X X0/ᘔL($ 40,@<8`THD\0ST  @  01S o00; o0C 0/᜔D0@-P@0M50Q  0 RQ 0Sc000 Ss00 00Ѝ0''0p@- P0R0rP0S@ +Q QP`p-T+T-T00nU`0 pU rU-T\0 R P0HU-TxX,0 R$0+TL$P0Q@00 R / 0 S/P/h-MpЍ 21C h 0<<S<ҀC/0S 0<<S//-Mp 4 21C  ЍЍh0@-MPp T0"!B@00 << S   00Ѝ0h/0/d0 /d0 /d|// 0 @ @-H0Mp 80 R ,wЍ0ph -h0Mp XT0 L0RЍ Ѝ 0vph+ -40Mi(0( QЍЍ hp00`R c xx0@-$P$@MQ >@Ѝ0l G-M>>Ѝ>-M>>Ѝ>-M$> 0 RЍЍ>0@-dP M0S@ + vP0S 0> Ѝ0@>-MD0P 80 00S0C0Q Ѝh@- MPp@@ t T Ѝ2r 0S2` } /U@t" 0SGTI U@4"Pl0SC P`0!S @0<<ST T P^ A(0R 0SD 1 R@ 00<<S;@H>T\0 S( S %  1`P@0<<ST7PV' 0VV 6/P=0`zPPT @c0S @] 0T; HH<=P~) (+Hl GDhl\0@- R 0R 0 R0 0 @ 000 R0S >0 =3P 3\0PD0@@,0 700 ( mv,)!/4p@-@P=,1P9 1P 0s 00SPQ `0S+P 00T& 0\pذ0`00q   Q  T  PEUp P 0p<`P0ST0Sp 0\phpd@-Mw@ p[0S SvT0S H0 R d=\Ѝ*=v x-MvЍG@- MP p@  xd@ Ѝp P4@1v,q` U@ 0ST) 10<P/(p) 0"!B 000v0S0 RT@Ӽ@[0S S ~v8<0<@ꀧ)hxE-PMp 1p W Pڤ7@Z0 S00@S 5`P BL vWBk=4J<,1,W`P 1`U90s @ 0s @T  0A0{U ᠡ   0n  0R 0 n0W`00 0 0Ѝ80%(@ȑ00`dhH 1S R 00S/0S/+Q/ !0B;SIMLMLMLMLMLMLMLMLMMMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMMMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMM8M/0(S Q/0S/Q/ R/!0A;SIxNNNNNNNNNpNxNNNNNNNNNNNNNNNNNNNNpNxNNNNNNNNNNNNNNNNNNNNNNNNNNNpNN/0(S R/0R/R/0/,@-@%zT0000C0@@0@-@zT 0S  0 0S \S00S00 0@-@PMP5 0S %B T!: Q U Q0 S S SL T * Q Qd0 R L T:00Ѝ00 S 0S R +p@-P`I0 S)Rp@@ f@p0@-QMڨ0PU Ѝ0PU 0@ PQ0$y0Ѝ0@ 8@PP yЍ0@z P+0@-@MP0@S ½p0PTd0@T 0嵽@PTU 0S Ѝ0@dЍ0++@-`M0S|p@0@S 0\PS0 R -`  0@0C00S00Ѝ,0O-PM7 pWI Q 0S20 PR `5 0@ TPyp`0@P dp`W XZ Z0  0U `p Ѝ0S 0S m0h P0bx0ЍO@`0@-0PM@Ѝ00S (PP@ @'E-`PM@p QP00`U 0 00 Ѝ0SP 0SP00`U/,000bc_x@P@-@PMPp`: 0@S" *S HP Ѝ0SQV00[P 0@S *S0]SU 0S00W00S00V000]SR@S@O-pQPM@ @T 0S 0S*T x0`*S\ *000S   00S0R*SI *0000 R  =@V@ jT) U 0S'Y YK YUP @0`0 R  @P/ `DT*PPЍ0S 0S?0Q\SU@`DU0`0 R  ?P`(0P@U@@T R  ?P(0@0 S*R` f `E-`PM@ 0Sp0DSZZY@ZV衟P`YwЍEO0pS 0SepVᐡPPEV R  ?P 0@0EV4@PT0P0 R  k?P PVԠ@PDV0P0 R  S?P PwЍEPU R  >?P 0@0~v@ЍvpzO-`PM@p 0QSPP 0Scv`Ѝ8^PH  AIpB  ;Ip9 0G S@^\]]P,0A0p0 R  >PP0nUp0  Pv@ 0`@@@   `PP1DpupG R   >PPE 0@0@@ట0 QR   >P@0#T0PP1ሰ@up 0p0 R  z>PPE pOpK0@0D@@-0MP0 0@p `S Pp{]0 P0 ЍE-@M@ @PP/ Z`'0S+ S@Y]P$p0 d0S P T  0^ @Z `00Ѝ@ T0`P@-@0 @0T70E-0M 00@2Pu`V3 GP P1 V! V0S \P0Ԕ0Ŕ`0 d0S pP  0\0`V00 Ѝ0S0 Yp@-`P P00@0P@UpG-PMU@Cu00P Ѝ0 0003uT`! *`P\ PP0 d10 S pP 0`0 0a\X000X0` @-pPM `@Pp `0V00ЍE-0M@P 00= s0tP` P7 0S* S@0@SSS `@5\P0֕0Ŕ@0 f0S pP@  0\0`0S00 @Ѝ @E-@p*P*P@P M0S P`` EP+lP  10S 0W0U0S(0p  (0 ЍQPPw( 0]?( P D`P 0P  0*S*S@S0]S  D(0P`P0( PP0`P 0*S@S0]S@` y( 2(0P0@-PPM (@ Ѝ0E-0M 00@0sP0S SS00c[P0Ԕ0Ŕ`0 d0S pP  0\00S 0ЍE-@M@ @PZZ%0\S) 0[P$`0 d0S p#P T  0^ @Z 00Ѝ00\S`S $S@O-PMpP PZP@@ Q& \Q. [Q000/0S0S PZPP0 dl0S `P@@Qt@ @Ѝ0 R @B0]S@@ `*- 0M004p21Pp@-1 0S. Qa,0~@T& Q  Q 0r0tZ@oZP\q0@s p0 0 pT0H0 @80 p,000 p@D++,++ O-Q\M 0 @$  0S @r0S00 0SR T   r 3( Q R0S @ ZPH Ep LD Ep, L0H400D*S00 *RP r0P*S *000S   00S0*S *0000 6 4R  :U@ T $P P P<04180 P , <0PR4a@< pR`F0Lp0 R   w:PPE0 8P0pT0 P $0AS[ R  0S 0S  0S!`rP$0S  \ЍH~P $ T0PUh 0 T0@j R2T9 QB $"20#P0PRT0ZPZL (0Q0S 0S*@Q  PU 0S0 S* @ R qT  0   Q  0  4P>PHLD U<0,0<0<0Q0.0\S @D2Q 40R  9,@P0M T0S   0S0 0  , RP40a@up`F 0p0 4R  9PPE0P0pT0 P 0 S :@U 0S0 S* q^ W00, PT 1P0}q` qP@@/@+P`pU O-PM Ѝ0S S 4 R 4 R4 R+ 4 R' 4 R   XP`4`T\40@0GP@(]<(?XP YCnkLQxW됰[ P p `P`FV@T 0S00T0ST @p`FV@  B`PPS Np00T0S 0 0pY00W @' 0 W I0 S 0 SG0pSApW002Wl2`2`"00<2OY $2}  1G [ Y$W W50S:0 Y1@qT 1@kT 1@eT Vl1@]T X1@WT D1@QT V(10 \ 1 0 iP0 RP P PP 0|0,)_ml0i@ 0 00t:00C0$(+d` x)t 0)+)@O-04M'S( $c 0P@pT0 TP VP7 `emP1 ,nP*[8 ,nPVP$@`0 eh0S PPP@pT[   \0P4Ѝ0S0S  cP P  mp@@%o  mP UPPVP50@P0`S'S p yVP d0 0SP@P@0PS'S` p  [0 S@0D0@P @PO-pPM@`@ЍPU P Q 0 Ss Sz 1VPN0  'V 00 0@SW S S S` ``VP g0 l 0S_PY   Q 2 Q, Q Q Q81 RQ00 S 0S Q Q Q  0S 0 S S S S0S 00}0 S0 S0S P P PT0 R{ PVP@Pb b+O-P$MP  $Ѝ R Q  Q 000S3 R  R R R R\ 0S R mUP  0S   0]`P 0S S0S00 S S S @070 0bI 0S S S S@@@-UP`i p0 l 0SP[   Q  2 R  Q Q Q Q R 0SQ Q00 S& R# 0SP |1 R R Q Q Q  Rz Ru R R R1 RiQF \0 S=0 S:00s0307pW G᭱ ֯0 07000jZ 0S X Q  @Ox +-P ,0 \Q @-@PM` `pP`@PU V 0S @Ѝ`, -LM`UT10 `QSq7 @T 0S 0 0 T 0S Р(K脠 R t& 01X` @P+`V 0 B @+++ -LMTh` p `QRA @ 01^Р K0 B ++O-PM( `p0  @1TP @`pVP 0S` W`*Y  @ЍJl@@C @p@0@-M@TP @ᡸЍ0_@0@-0PM@Ѝ00S PP@ M@ሸ0@-0PM@Ѝ00S PP@ 9@tO-@4M(@,@p000kP @`Q# 'Q= \Q( "Q! SSP20(  f00S@qP@ P 5 Q`4Ѝ 0P0c 0 P0 `  \1!@ SP0P0 0 `P``SP , @0`S'SP SP d0 0SP@@0`S'SP SX0PS@P h Pv@@ꜘO-@Mp @@RP `0S& `S$S5 <S3 >S1 S/ ~S- \S'S$ "S" RP@P0 f=0SP``0SZ  kP` 03/@PP ;PvЍ P pG-PMPx @Tu Hp{j0`=S 4 j0P02 RD Y{ @F+00*0C Ⴖ00[Pp:X 0p T0St o=@bT?*(- @0+S000UP0: 0IH0S4 !7P5Y[㺼P p X  SЍ h=@P'  0:0 10s3`jXPU~x 0 @@!PE<*@P 0 0S @  ;x @r8$X@- M0 0! Ѝ- M0 0 ЍO-PLM@`p<@@@ 0@\  RH\\\P \ `[  0PLЍ$\R }\j `\ "\'\@@i'\0PDP(0$0   P`P$@0\0'\\`i -QP e00SXPPQP<@40 e0SLPPP `` P0`00{SP` (S 0H0! @1!@'D0P`w[ P`qPP<,0 et0S8PP`]PSV P00`M0 R% 0   Q  VK 0H0!0X D0P`)P`#0 P6\܄)eO-04M@$0(00PS [!\S@ Z2 `SjPP$`p0 d 0S8P@@0PS4ЍPPP@$`p0 d0S1P@@`S@ $S "S2 1PP$` p0 d0S@00{S(S(S0,0 , 0,0@@( @, 0@?@\܄O-@pS8 V0 @D$ $0@n0 Q\܄O-P4M0V QS R @(@,@7dP 0(pS ` LP 0C 0@0S 8T8P0 dS(p ` 0 Q p @P 0 S S S 0P@Q ᐶP0S 4ЍX\ Q00R00 P Q Q I Q   0PX00S  Q_` Q@የ ᴦ000Q00Q0S  \ r  Q QR 0HSs RVQ  0@'Pb [0 S S S[`PQq00 RCXQ  Z\0Yz 0Sw ZOs1p WP [P<  `Q0@ 0` S S SJPQ ݵP0`X 5 0 0 0R S S# 000SU r00 000`Q 0@SPQO 妵P` G,ا    `<,@-0$M@ 0@Ѝ\܄@- M@ 0@Ѝl@- M@ 0@Ѝ\܄O-@4MP$P(P0@d0 0*c0@pPP R8 U< {3"R00SQ 0S l2!@ \00pxJP4 0$P` j0 0S>P  0^0@ pRP 0@4Ѝ\R@P 0S `R 0p@00@0Pp`R0 @p0 $R "R[G 0@0#00 `{R(R0(R,0* , 0$00 0P p 0S 0 0pS,0  ,@0Sp@Qf dL0 R4@ ,( (0@&@ꜘ\܄O-pM00`< 0S]@'0 0PL[P 0S0: 0T UT 0S0SV `8 R 0SW* 8 00᪮+Y-Y V5 /b'@P 2 P  5`ЍP0 00S00S G 00! @a@`0S 0S`"`0`70O-`M#P@ ! P/0D @R 0DR@ P@U :Uo /U} 0(0 00@#T !T 00D S $ \>!    #Q9 @Q $Q @000C SQ $ R  0S\0@ \嗭\@Q@ 2P Rp TpU}U, 0Q0# \ RnP M]@ \ 00@p4  @@@,D@`,0pSb (S`@ V )SPPU`F@R:S  [PPUK@R?S@ HPD匀| d0/0SXP@@$0S0i 0S@@c?\#\] @\ *\000U0 S}R@W F p@W*W@0 ]W@Lq1PH v` pp0P V 0*S@S0]SH L0@ 0 @06L1P*P\ %0S@00Y00S00$\00Q @   M@[P P0TP PT  j ,Q \ R U6 @:U DU@P 0S0S00700Ѝ@Q 00 S}RL \ ,  XIV,0S \@T  I(\ \Q9 dɟ@  0@p@. ,4`,, `p p,@P0@p/SPPP  0S /S 0S \S0SP dY 0/Sp #Sp %Sp V񟗥ؾ8нؾ œP 0@0$@H0p|p3SQ0 ?U-U #U U)  P 0 }Rt @0?S-S| @@Hd'0;@V_0 0!S 2@G00  _\P&0kP $ R  0 ,0}S100  00!S0?S#S @S *S\0psp3-U %U +U #U,Q 0\ RS 0S$, $\@@$#St%1:~ P 0@P( @00}S~  ( |8ş8eP@0  'rFPD0 d@G0  )_\ 00L S$?\#\00 @\ *\$0\$P ,\ |\Q wL4U 4U& @P$ >0 }R Q0p,`@V0S 40倰[ 2ꌽpC^}P(0 0 d GXXSXc0P)?U }U =UT@T@W@T/ +U ,PUG "DP (0 bP Y@ 00@@ 8< @P80s: Y< YR0hŸhbP ?8 <0EP@@TA 0S> 0S 8< 0 0,PP P@PY [ PDPLP LP0 0j@T` @i`PU`0`Sv LYbPL坪U 0 IVPP U 0!  0S 00A SӚP.P ZP `x0V0@y괨)Ȩ0)$+( T}40 Ry F,PU O\\ J Hd0d h0P@0@S@nE0  @_\A]P;@@@ `V0@ *R  00Y00S00R0p000I@p\\ =UQPE?U +U  @00Y00S0S 0 ,@@P,\P T@00T3 0S0 P J P+ G@P% jᥩ @ Y[@ W& pXp%]X@#PX :00B.`p0SO WG[ <0 Qʥ 8<0@3@[ 񟗘0@38`H@8@PXU@@P8@U T<U =U2 0\N> RJ UP@ T0 P0`0`0P:U   >0S 0@~S:0 T T W   $> R  , V00r0S,`,0S0~S :0`U ~UJ \U0 S``}  ``@0@  d-1P T`FP` %?PP$Pt` l0 @PT@0W0P00 ` T`00U`9 0 'V #   `  @P0:0U 0S 0SpP 0~S `0P`` :0<$UM 'U+ @5```T@X@>P`8@`8@0pS'S >P80TPL` d0C0S)P@@0pS'S C0pS0@S@ (0SᎺ( R 0P`C`0 S00@$E0P@ P @4:P (:P   R 0S00Q 000PUM R` 0S` 0kP @ 10 0@`p```!`)0-Xi@P L9P 0 S000   CPT `0S````0(S `F`s0 p```M0@S (T 0S CP@0 `PPp8@P \8P ᛢT  0S 000PU 0 0R0000S00T 0S 0SU WPᵢd @?<   cb Vg 0Y0SP ,7 UR v(00Q0S0 000 0000 0 900 0  000 0900S070@U``d=P 0SU00 0CP0C0S n 0 0CS& C=P$0Pd` l0 0S@P@UP0 ` T`00(0SvfP  04 R4<U *`P<`P < 0S 4@T5 P<PUS M0pS  E@:``<P0`C`<P@P$Pl` l0 l0S@P@RU0P00 ` T`00@ ᎙070Pɗ@000<P$0p|` l0 4@PNT@0U\0P00 ` T`x@D@$0P` b0 0S@P@T0P00 ` T`00M@0 % 00000 0 900 0  000 0900000p0(Q00SW ]P!\P0``0 S P0 @ 0`Dꀠ S sTr`0S( 0S(f c``@0 PU 0`00J+ e*+,($@`X,`Щd(+0,\S<P>U00>U0010LL@ 4 ` 5T P@ 0ᖔ# 0S @0Vp> P@<00V000S 0 g0r$0T U l!@pPj \4@:p$P@0Gb `A\ ZA0~SrPmNL@00XS00p@00w03 20P{' %"2T@@n0S0S  <:4:P ur ¢0#00@#000 4;P\ w< ~Ql n<w4Q ^:CP `00U:3 00< bPC4 O<XPO-0P$M< 0dW0 0V P DP 00 00$ 0Sv@0000P 6 6R6 R@T借@$ЍP0x6 R Q 0  0 S600 Q0Z T `p#U 0S \>Pq>Xp `0 9 S @ 0 @Ed5PPQ X5PZ 0S 0 @PP 0 0 900Y X 0S > 0S~ xPz d4$XXtPP@005/PL4U000V @Tޞ@]0 @؞֞3  /0 @̞ʞ3  #3Z RZd PW 0{00nP ; 0&@T/ P 娵@T" ፖ` p0R P002 2R2 R2  ] 000S0S j[ 0S x=  ^W[ 0S l=PT p0? 1 R;-0@N0`@yZ/ p0 @P 0`P! h1V 0S P@000<0@SP C=? 0S Q`@00@0@0S0 R0 R| u:0@Ta pE$+) +8+,@-`PMPPЍ0S p pCQ;@0 p|0PPp l0P P U P " 070k᪓P@-M@X0P P0P Ѝ0080 Ѝ@0  0)- M 0 Ѝ0@-@8P M 0@P@ Ѝ0@| Ѝ00@- M 0@P=U  Ѝ0@g Ѝ0@-PM@Ѝ0S 0 @0@-0MS@  0@PU @PЍ0A-QMP`p@Ѝ0 0@@p #V`\ 0%S00X   P0 PV@U ٳ0 @ ! 0@`P 00  ẜ @T 004ḳ@@`P 00 @᠜T CV@P T0#S  X00$+@-@PMP@Ѝ0S p0+0 O` 0`@P jT` P  070p@-PPM`@Ѝp0S @ @`Oƿ 0@@P ;0@-0PM@Ѝ00S PP@ @T Ѝ0@H@-MQ@P/ *Q@Q) 5! / 0S,!0AS񟗈0LPXLLLLLLLLpLLLLLLLLLLLLLLLLL|0S|PoЍP *Pl @6PT 0SP`T ɲ @P 0 /P4 RT+ 0 P%0*S@S0]S K R00P 0S 0S 0SPoPP`3p ᎏ@T 0SP` 0SP` 0SP` ᅿP`۲P  20S wNݾ$00@PPp pSHC6PUW 0SP`W] CZ`2F@@@2=@0SeP`]0SdP` 0B00@R0B0P`@00 qR P`%T; 0S8 0S 0SP`2 P`-P`W 0S 0S 0SP` P`p 0e@5PTJ 0SG 0S 2P`P`(P`#P`vҾ)T, 0S) 0S 0SP` ¾P`ꜘ0d+)@-PQM@$ P  7dᕱЍ@葱SpE`P d Sᄱyေ84 H 6AЍ@p0@-0PMPЍ00S H@000PP0 P  070vp@-0MS@PЍp0S  0`PP T[P&@ P'@-$M@p`mPP5T .M$0@P0䐽0 PPP PUPU+ $Ѝ P)jP @T  50S+ ) "@PP 0S T@ذ@ P@ 0@ s 3P R 0S 8@@ 0=@PE-Mp P`U0 $>@ᢰ6 0TP 000C S0S0t   aPᅰЍ[@ˉP   0ꜘ@-@l@iP1p@- @R@p01Q P 0 ` PP0.S0/S ]L.0/ @0 ⽼f?PP80.S HLp@譼AL᧼@/ @P P00 ẍ/0P0@)ꌔ4x`0@- R P0Q @PP 茔40P/4@-@0S@4E-`Mp\! @0S*  3PP ʯݼ@JLB 0X0000/S000ЍǼ5L-0Lꌔ4P/Q/1(00`101010`!Q/@-@00C@-`PMP 0S  R p0AT @T 5/PЍ pR@-@c@`E-PM`, 0S) P$ q@T 6/IGU@ VP?=;U@ 0P000Ѝ0@-@M KTP K0T0@ 01 RЍ0 K@0@@ E-PQM`@Ѝ0S [ 0C01@T p0p@S 0X 0SWPW000000C0E-pQM` 2 / 0C0@PT@T 0U 0S.P000Z@Ѝ3K@ P0 0 0@`0S@-`QMp@  P ЍP@ K P@D@0!0 0pG`O-P M`A = R8p0 @0T0+ PJPkJѺ0S V 6/00 0@T 0 UJPMJ峺 0pR 00 0 ЍH0@-@T80 1 \  <8@-pM0S`x`P0A P0 P @0 0SP 0 Ѝ<80@-xPlM @1 忙P 0H 00 P 0@ lЍ00!0@0@ 8O-tMY P  ԺBJ:"0SxȒp"p0Sp0a 0S   偙PN8@0UiX0S, 0 X  ,嵶 0@0gP<0ST80SP0 0SX_ -@PU tl1 R 0@APP<0S>P0S nT 2 }8@000 R$P0@P0X 1 R 0S  \4tЍTB 0 0坲0Si80Sf`0 uS00S 8 2( 2p<8,T<(O-lM`V"p@PPU 1 RVP ᾘP 0H 00 P 0@ Ѭx002I@@KI 1AZ  ѹ?I 7PlЍ<80@-DPM[徹 ,I (@ᐾ/00Ѝ0舐tp@-0M0)PP`#  @P  0S R \S  %S?S {v@PЍpS 8@P iPP c^-M0Ѝ@- MP ᘉP 0S0 P 0 0c ?Q Ѝ PX@01B/0/D! 1001/D0/D0/D0@/D0! !/D-0/D 0@-@  101-D`00 @D0 R 8 | /w t D><!00!/$0P/P/0P/D/$p@-`P  0 P  0 @1 |0Q 5/@AT`0 R1 !0 1 !<0 R101p/  Dx/X\xp@-X`@1P @0U Q@0A0!11!0 !pD/,0@-@ 101-DAPPp@-@ CPBP``1@ 0T0@T0S 1p@p p@\P\0!R011S101D-$APPp@-@ CPBPA0DS%P1:1 0!0 !p0P0@P0SP1`Ppp m101pdP`P`0!R01{1S P1010oD/-$p@-jM  @  11!0S 00 @jߍp 0 01忷-G%410(!$1 f10S0. A b/2 A`P% id剪P0 !00  @! R |0|Px b/@2V @  tV`_ 1 0 1D/$) //))+|0@-4 M 1Q0S Ѝ0PC@v@D) 1Q0S/BiD@-l0!Q@T PA[H0 RPQ (0 R 0@D)+)@-a1 0QPqMU 00 Ѝ@}Fu0 p00P0 ph@0P00 0S 0S Pp0X000 0 0L0 dD U8G@ 00 0D) ///0)+)@-`p`3PAPM@P" CPBP (a!:q1\& \1 1?ᰶFЍ@1ᢶFV 0 RЍ@011S1!01ЍၶEЍ@D-$!CBACP0P/  .t2G-!M0SB xxqta0P0PAUp`4 0S @@ @@ x@U  7 \0\ d@,E咵 !Ub 0  P0V@AUp`܍. >P` v.@ 1[g@(0 T)./Ԫ$T@Pp@-@ʠ01S S $0` |0RP `0 R T0R qPp@ 7.p@/(0 $@.?/.T,\/4-0M1 @ P AP BP ЍPNU1DO- M ȅP Q< Ѝ0@P` @T 0S SS p W  P 0P@`DU `V  ᾴP` 㱵Pp ۹P  @P ᤴPt2xp@-D!00 1110 1110000@AAA0ASQ a0D0D0SD00D0D0 0D0000S0000000 0 0| S 00 0 0Q0 0pw0<0r<0S<00<0<00<0p/D$-.  pR0 B /\d( 0S 0 R0/d)ȑ\ 0S P0 R/@0 R/0S/0 R /d)ȑ0  /X404 0p/0S 0C0/d)X0@-PM0S0 0A 0P S0S讄P 0   Ѝ00   藄P 0 00000000d)Xp@-p0 MPЍpaV 0 R0 00@P t044X0@-@PM PP 0 !Ѝ0X@-@P@@r*-PMX0 Q L0P P ЍЍ\*" 00ЍXp@-L@LP0`0:C Vp1@@0T0pX@-tMP N)P0@ 0@3Q`8Q P``,Cp)Ct0@ Ud0V 0 A ` 0tЍ P*@X0@- M@P(( P0 P{b Ѝ0'ȫL'-M)PЍЍPG-P@P: $1U P5 !0S6 PA A0S  R 0R01 )p@T` B` .0`0SPY S X0 000C0 0S0SOd)Xp@-aP @1S t 0!R  ~+᡺0  0S 000 0S@ &*p *p@ *P 8V+^@ Xd)$0ȑ|@-@P Tp pA-@P0S1`p 0S R㼀 ኈ 7)P !0S0S `0OwX $)P000 00009`\d0@-(@0PM0P(0d8E-0M 00@G0?`0SPb !0C<S>X:999999999X:99999999999999999999X:99999999999999999999999999999\00@&P0֕0Ŕ@0 fl0S pP@  0\0`0S 0Ѝ0@(S400A-@M@ @Pį0pS ?SP- $!S' /S &PPE@0 e+0S `+P@P0PS\S0S P[S @S0(SЍ0p*S +S0(S]SW00 /@-FM0@1 : : 9Fߍ0-M 0Ѝ;| @-@Q00` P T0 RT^@9P  0S/0080`!p@-0S0`0C0 `Rp44A0S(!C€000S O0SP 79\0S#0 SV00 0S 0 R 0 R V P !\0\@v 㱄v0S )@)00) , 0S000 0S/000@-|0M RЍ000<9T@P @T gPhP 08 A-$FM R Fߍ 1Pa0!99#9 @ @9T@p @T 4P` 80 0R P Q P0 S S @q8T00  h8 <@-p@0Sd8X c8H80S ,@Ŀ00> =R% >R<R !R) -R /0S/Q 0StQ eP' eQg@0S,B,02 0S =S0S0=S0gC R$ 0F0S0 p3Ѝ00SP Ѝ0@(\0\@-0^ S00@ ]Tp3PA-M`p@ 0@SPЍ{PX  {PU WLLLXL,LK@ P0S  0R 0R 0R 0R 0R 0R 0Rʹ 0R 0R 0R 0R 0R0@-M=\P@ >\  >\<\0 !\% tP4 eSR ePC Ѝ00SRS aP0S+Tf 0RPp3=SPTn 0R>Pg0CS@OpMpMpMpM$OpM ON=SPlSG nS> gS0 Ѝ0@#fP- qP0 Ѝ0@  Ѝ0@9 Ѝ0@30 Ѝ0@0 Ѝ0@ Ѝ0@ Ѝ0@0 Ѝ0@0 Ѝ0@ Ѝ0@E-1 `Qp@M =R <R>R !R$ -RZJP "0S0 #000Ѝ0S =S0S0=S 0 000DG-PP`Qp@P(-P  0!S& (S1  "0 100S0aS  aSoSR%0 R0 R0 0Sl 00Sp30 )RP,0 0P `DO-1衟聟p@M^:Q!`!VQ( 10S R@ `0!S P p3Ѝ /(V@8 0^-V 0V0@0P ЍO@0SP' ЍOa[0^0l0 AT 0)S0S00 ` !H 0@ !( ! 0td(@-zl0@h QX0 !0-S 0aS0S00TP@@@-h0@d QT0 !0-S 0oS0S00@@(0-$ 0MQЍ@-M,`2P2P 0[SA 1!Qe 1B Q VVVV\V1Ѝ 0!S8 1!0QMx1 p 3T -2D1D! 0,!0Q01@T  B !R 0]S0S  !0S 0R  ^p30Sh 00X00T0 81H (0  1@-M0Sx0@T l l0h \ @k4Ѝ0 00, $ kd\`@-@( $kT @k~Ȭ 0S/\S S/0S/@-@@E-ؠMP`ЍP n7 `0Sp0\ @Q 0\0@p 0SV   024`Z0 0R/ &@-,@P LC00@..PY̖0@-TPMQЍ0 @P 咚ᐚ.0̖-(0MQ PЍO-M`ጧ66 0 0 00  Q P %  @ Q Q pp \Q "Q'Q Z 0@Q0P R @Q0P[p M@k0 XP 2020P 6  ֧0 3QQ x3 R  @  彧00\㶈 0PS_ Q3 RY jPU P@ 00Xp 2 R F6Y RT4  0R S S/00`00aX{P @ 000r0@S{ 900    `. 00    S10S0 ᯦ @g0XP 20 0S0 5 80 0 0,0P  00Q 0@a Q Q, @ P@PQ Q Q P 0\S@ "S'S?0@SgQ  @9 0S pQ  @,8 ЍLT@-@P@5@襥-$0M0S PЍ@-@0S@- qM0@S` |PP 5{0`` 0P S S00Ѝ p5Pk5cd5\000P S S00S5K ,P Ѝ@L,̖@-PPMp`  0 0 @S @0S 7/PЍA-pPP` 0  R R 0S0S 000@ \   0S0 @P0-@P0/ 0  R R 0S0S@-@MpP4W`0 c4ɤ0 00ЍE-PM 000R00S ЍZR P `0 `@pV  P`p  U  0@ P\ 0 @W  0@- M~4@P 00@   Ѝ0@-pPM`  0 P0R0`0 @   r0 0  0 P0SЍO-P M + `Ǥ P pU6 @T [6Ấ 000U[Tp 0 S 0p `ZY00 ЍPS 3[Tp v@3@P᧾@P@-0 @0@30@ 0@@-@PP O@LA-pPP`,  0S00 @0  P `   R S T R 0S*T 0S 3傣S@0P 0  A-QM P`p0 P0`@pUЍ@-@P@0@-PPM 0 @S  @lP0@ 0@ Ѝ0PA-P0  ^000 pR^ 0 R^\, 0 0 00 \Po Po0S@ R0Q 0S@0 @ P W PUp   0 S0 0 0@0@P0@ 0 @ P p@-PPpQPp 0 @Q o`P 1`0 @S@-@PW@"O-P$MP$Ѝ 0 2(00 P pRm ` 0rP j 0S@ 0S @ 0S @xZt 0Sq 0S 0So0@PQ[00ZXX 0SU 0S 0S[]0= Z0  AP 0S 0S8 0 S 00Z ᬕ pW@T`T2P 0 S)00 x *@ᐕPq`P1[0P0X ᑢ ⌢@ ሢᅢA-P`0 {0` PS  p@T m1ӡ0 PSp!00@-`PMpЍ 0 0 PS p@r@ vHtp/ P0SW 0S Ѝ@.p@-PP`p 0 0 @S `u%t @0`SP 0S p@E-P Mp`@ Ѝ0S  00 0 @S  0ᔾPP P0 @S @  .P0 0`@ Y@ w@`A-PM@PЍQ  0 0SC `Q 0S40 $0Q0PP $ 0 p0p `$0@ Q S0" 0( R ,0 00,0  P0S* `Q P00S:꺶PA-PM@0` D@PPDT0P@pFD0S Ѝ0  *$+)p@-@`PP  ,dp@(0 V p@d4d`E-0M 00@)pP0 0S `P p`@0S [S ]SJZ P@0SЍ@pGE-M[@ᓂPP' pd0P`0]S ΨXPZ00Ѝ00٠G0?[0X000Z0g0XPZP 0@-MPP@ @ᦓT 0 @Ѝ0p@-M@ PPЍp 0*S@S0]S0Ptptr`0 *RPm|W@᪺Pn!`PA-M`  @pPQ 0*S@S T00 RU 06PP0]ST\0C0V0 UPU 0PЍ0PC(0[  CP 0@" t5r`0 *RP |0 PP@<P`PP0 0 p@-[Pᡁ@P ``o[0P0p P00]R0SP0 S S  0 S S Rpp@-P` 0p03]R0S00*S@S@T NQ 00PpMppX0 @0 87p$0  7plhtE- M`p 0`@`pQ P 4/PU 0@`p@T 0 0 PU ЍG-M,p`(* .P[. 0@P- O.ᵞ0 0 0  ᳙@\  0@  ᤙ@\  0"670S 3/70S 3/P`7 R᷒@`ៅ!" PdV 6@ R PT ᙒ" 6@ᐒ6崆 VR 6Qy V6&6&\ ^ވlFP W\0S , 00 %0%0S㴥Е50@S@T@M5P 0 R `PP T5``0S7 ~SC .S< L5P % e$5($40 $005P 5U2qC 4 4 @P4UP@p 0S 0 Y ` 0S  OPl00^!d$0TPC/㸒PP 3P R3 1@p@3T ӑA!93P R'P' 寄30|3 ]@p@3l3G@ᝄ囄PᗄP"`PQ P Ѝ 3Qh.億00a `P-0~S* !P &$꜂l`Pr"0A0TT V0 0R ˑPo ՐPH2p!W`PM 0 PG 2V @ 0R ᦑPJ꜁1h!`pVP 0 P 1W @ 0R ᆑP*@000 ^00  Pn 000 `h0~p  Օ0P0S|0`^@ڃ0P8H @P$7<,0(XT8D4 x@-M$\@p`_ ~\p l2 R 0@Sc 0< H2 RVQ 0S. r00ePP^ 0`S^ @T' Q$ 0R P]P_@P0~S P !00@t!t1 jPPЍL.PP 0S 41 RiP'S 0(S5 PUPP /qPPP 0 \PF_P@0~S P P0 000@Pꐖd2THlLLtȺE-QMLL!3@D1 P ,A,q0P P aP ]0P RaYX Ԃl0P0   00P0000ЍԏB:͏@:1*0 0 PL8QA-@ᘂTbP 2@0`S0d@ $S \2\r ᝏ $P ~2@ᏏPAT*Q Q QQ0PES * Q QI Q qP RA: + RP PP 0Sx1   L h1 P! LA0P V(q0 PR 00 箎0000  P0 0 b 0P S Spߍ0(S0d@vH0 <0P80/  ЮhO-M"ZPB>  VP6 AT``@T T T T T #TT P 5P! 0 S0S S S S S S S 0S00 tVPTߍ00D S/01S/01SS S S S S S S 0`S S SS  0` S S S S #SS ?1QS S S S S p S S S S 0pS V1Q@f Ȑ00 S? B` [@P ῍ 0/01Q`?=   c@` b 3h 006txخd-LMⰋP )80 R0 000Ѝ墋0PꤣdO-@QMP2\"P LD2@@ <2@R8b 000@Sk `V: BYg@pT@ 1 0Q0 A001 1p!P@ЍQ0P ҍ@X1P D1 @ .000 ᾍ!0SppP`@ 00 Q) @0SYP0HS0 @! `0SV01^Pp ?#>   cbwgp ՍP`TXd\- 0M R8 0ЍdA-pQ@`(\aP GLQL1p 4$R 00 0{S00KఌD 0R Zf屄0pP@P0P ,`@Q  0犌Pd`U 000<0Q {0 0 |thlpx@-4@P i0 0 <-M?Z0 00 (0( $0$ 0Ѝd`TP0@-0@MPl0S Ѝ0蘖$O-PlM$\nPT  GP01E@`@1Z0.S Z#@e[P`@P+ ᖌpP/W7 {@x lЍ0Sᄌ@`P3  0R& ][Ph`U`nP a @PXP 0@ p᧋P0.`8D eO-Qp4MJ$ 0 S S"0G 0R S S\* P3#0QC 0`S@)P0O  3 RXU Ѝ'S"S @PPLu 0@ S S  0R@ S S BPU:Q mP 2 0&R0S |R>S {R$S hPU"0`S 0`S@ x"娲P Y@v@2H"圲Pg02P R P2"0Q2P ~0!`00 R `1!_WA !X @0 S S 0` S S d!H@1  `R800V Z~Q` 1  1  P0  PO M  0PE  -P @P0p03.>S<S$ `[P 0 -$0PX\)x)ȖЮehȺG-@PTpA "Tv 'TE X0~SY@X X@Xo X X`P Qg`PPP@ef`PPPT }@VPMY00X0S 00B} qlPD 0"SɊ60pS@ @P 000 @R 0S \S 0JlP\00000S00}`p0 R `0@T g`PPP@r!%lP@rp@2x0p@-@\R`P 0S  p@N 0R ʼnPdp@ɉ@-M(_0 0 @P 0SЍK᱉-O-M`p@0 R 40 PM`0W !) 0 0@ᮞЍT`j\X 000avnPT)(X0777D20 80 R 0 0\h@-,@,P0M`p0`pЍ`dH?*ꬫ??L?L?O-T0T@TPT`Tp0L0 M 0 崌Ѝh`dTp?X0@- P0P@RL0LPp00`M0 㕌p`Ѝ?㏌@`dO-@Q Mc࡟0@Sԑg0P3 P㼱* pP 0S @P 0 1P0S 0 0SDa01  ;c.|P 1@7 PUp`" 1@S ᤀ @}P100 10 ЍOX`@P\ Up` Ѝ,,#b@@@z0P`<00@- 4@R00M (0(P0XPЍ0X@-@1@A M\pP$! 0 S S @aTBrr0 @@P P0  {*U =U# \U Ѝ@赌 0 S S000@ rЍEw@Ѝ@77X-MЍ-MЍ-MЍ-M܁Ѝ-MԁЍ@-,@$ ^OМ6$@-㺾@kPd \\ 0S L0@HH D0 00CT0 0@d8l8<@-<@ R00b 0 0 謖d8<p@-08@ P`0VPp wp@nP2x0p@-@[Pp``XP 0H(80@@@@V 0p@8X777A-``p@`PzV000V,0` R RAǼ77XA-dd@dp0P T`PP 0`P P z ]A;$P2X0@-H0M@P PzU Ѝ0X-,0MoP ЍX-,0MP ЍXA-@@p@P`PT 0d@c @77G- q=PP3 @9zT- `B/zB娆@TP !zU ֝@c)z V 0V `0 S S[@P00X77\!E-@P0L10@D!<1@!  81M R?(qQ/ 1 Q+ P@ `t`3PT耟 PT ЍކKV0@@00:@R  QR y@T X0@ᾆ,$(p,0@ᲆꐖp84A-ԄM`V Ѝ4$4ğ4PD4P@ 噗 啗 呗 南 |剗x t兗p l偗h d}` \yX TuP LqH Dm@ <i8 4e0 ,a( $]  Y U Q M I E A =3  #P#^L #Hp#C @ @`削SP @` @倊P Xf8#{*(#/& #/"~0 0`hPt 2Pq "~x"@p"@ h"$`"$X"!P"!Hh"g@`"*8P"g0 @,@03P: ,2P7 $Ÿ$2$ 2 Ÿ2d!ԓ!vГ!@̓!\!*!=1!1 !1 1!1 1  jT !щ !qԉiЉ] H$ LЯ(ܯȘ\ ,D`x8(H|\|h`@ܔldTP4$رxܱ|0-PM$  D Ѝ` DP/0 S /0 S /P0 00P/P/  0S /Q-0 S AqL ^0 S S 00 000ᙉ@-@Q 0S  0 S @Q᫄@O-RM`0 0SP ᘄ @Vpw 0St P@ 0` V0@- 0S* S \S* @g0SPSp R 0@gS) 0SPSp@ ă @`V00Ѝ0 S`0S   0S0 0" +P \WP 20SPS{p@千 w@`  ~@O-$M  0   p ` PU 0S [ 0S @V PPpU P$Ѝ`T 3P 2P R  V 0S`0  0S  00pS[ 0000S00@-@aM`P pF00Ѝ@-pMQP` @ 0S @Q V  DPP Ѝ߂p3@@-`MQPp @ 0S `Q W  PP Ẃp3Ѝ@-PPM`> 0S  0S \S"S Sr"0@0p^0" 0 Ѝ\^"^\00u ^ ^ \000V0"m0C@0"0@p0-`0M R 0S P 0S,0 R 0S0 ЍA-PP`@ 0ST0pp0 P 0S CS PS- 0P 0S:p1T `0S-p$T ` U PpTPPأ<G-`aMpP@0T` P0 0  0Q 0`00 R 0 R EZ`0SZ0Ѝ t0RPl@@. 0XPECu d@;uZ 00L)H)ЅDHA-鰀0Sت@`pP0:000@SP0 T 0@:000PS$cP 00:0ꘘ@-@Q" 0S PzutpdkTf$00Q\P̣أ0@-PM@P tT ́;3D00S 0SЍ0@Ѝ0)@0@-0MTS@ 0AS( CS= MS NS^ TS0ISk @/ 0SC RP tT ᑁT2P 0S^@0RP htTp y߀0S`]@)Ѝ0TPb OP10S 0SP@P@QP =tT M᳀@0US410S 0S -@P@00S 0S@P@@0ES~00S 0Sw @P@@P@x@<00S 0S]4r@P@أ̣0@-4@Mj~(P0d~Ѝ0@긣0@-MY~PL U~PR Q~PX M~P^ I~P2 E~@P 0S QP sḀ&\2~@P 0S DQP s᥀ 1P 0SЍ0Ѝ0@0Q 0S 0Q 0S ;0Q 0S l0Q 0S D0Q 0S ̣أ ,@-@<@P N@h-MN P 0S Ѝs  Ѝx-lM P: S 0 R 0R @ @lЍIAC8MP 0 @0@ꈐE-0M~SpP`@F XQ0.S8  STP r@? @@ @ p @0S( W  Z @rЍ p  xPP r@0 X4PjM@rx0@-M@Pc  Ѝ0@~Ѝ0O-R|M]0@Sz 2P 01 RPPgN@PQ\1@1 @|`Pt@J t0 t RhqB @P 0; CP$rU $1 0S0 0 Q P r0tt0  Rp00 0P 0 |Ѝp  @r\0PT00<<0  X  00RX}x-MЍ-MЍO-1|M`pM@PV 0S~5-~@|Ѝ'@,@~ t@t0 R 0S'0 R!t`PP 0 @qT P yqt0 Rd@P @a+P bq00@P Zqx0@-@MPXqP Q 0SX~ Ѝ0@} Ѝ0@s@$@-MPLwq@P 0`p @MP6V<@T !0S00S 0 0+Ѝ%M`P@`p@P" 0 R0 R P p MP@p }l Ѝ@b}$ @`pl2-MPЍ 00/P@-@ @ 0 SH 0@P R0  0|036 @-M{0 @R0p00O00PĻp`YV@ 0SE@YЍ{Y@p2-80 MP 0 0 0ЍG- @`PK 4q0 0O0P00vT` O00P 0 t } O00P 0 _ Y TT00ZP `OM 렄 -LM p0@ PGWU`=W; W4HH T00 S   aPWW  P T? Z  0GSu@(K`Pb 0-S IPWZAP9 HOPo  Q` 00p@vX  @  ,P\ >Z00)  Z @n@QP PP0[BP !@A0`{1PT Q 0fDQP@T\WAP 1PU0!P0a@<K0OQ@$su@꤀K P0: S $o@PCoK P0: S 0: S  0KP900n@V MPk MPe MP_ MPYM1a J0 { `0nz J  )pd v  pF lB r R Z$( K Z10P0m8!P3s`P0 0S- 0S 0Sf gX@S 1VP mT UP1P 0m!P0@S@.0M@*  @!PU00P@hVnm@D @P t]m0P XmpPem0S@X @1@WzL,ԥA-P@Up{G0 Sh 0SPAP+JP@0S$ #10S a0S 1 R  00Z0PS l1 R0U0@y 8嗁UAl iጁU `ჁU WzU N0@rylU 0S #|00S IP@( 1P@IP@갲|в 4p@-`@ lPP lU00T0 R UXTP @T pPP Ep000/@-@000000/@-`M@pT @@QUQ 11 R0!00 00ЍoQ 0E-PMcQ0S@p` 0S 001@ ^!@0 00Ѝ `@E-PM5Q0S@p` 0S 001@ ^!@0 00Ѝ `@E-`MQ0S@tpP0 R01@ ^!@0 00Ѝ P@G-1/`P`0Sp p1SPP0@x0xXP 00pPp-MЍ-MЍ`-MЍ-MЍ0@-PMP@$uQ00@0Ѝ0t2O-PM2 gQzPP' PpU* Z@`1Nxw 1 0 Zp@ `PU  !00` ЍЍOGP)x@w 00P` 0@-PM2P@8Q0 0@0Ѝ00@-PM!P@*Q0 0@0Ѝ00@-PMP@}P P000@0Ѝ0@-MPl`Op@P0 0@0ЍO-M`P`% 0SP# PATO p00S w!0w pW@ 00PPЍO P@-@,o(o$o oT0  脳pE-PMp 0`s@V@PV000 0GGsP00S000V0   ЍjP 000   0*   0 G(s#pꄳpE-Mp`K1IW5 PU% {'I@J!IP0FS0S 0QJI ЍP {`JI@JHP,JH@JHPp@-PQ@x`p`P i`0\ T0 RH0pGR]@hs ~      !/  4 P@JNpN}M?@P  l@P9 MpL3 <@P. MpL( @P# MpL |@P yMpL o@P lMpL |NsP+@^MpML  @>sP@NMpML .sP @>MpMqL  sP@.MpwMaL sP@MpgMQL7̖DXlЗ 4H\LO-lM r 0S @L@ H8P00 P M LL8 @T 0S_ 0SX 7  I'd0 `@j0j'@ 姞@T1 7P``gpP j  0FZ 0,@PA"c!O4&g P 0 P:U0  0 l 0S &`@0j  )0 p s0`@PT 0 P 0S 0 S 0 S@T pr 00 @PU" r0`S 00 `]fPU 0 ROgs00S@@Sp@@ܑP4O;fUB 0S dKp\- \0`@ @@0\ \` \\0 R@@0\ \` p0APh0  \Z \ 0e KK 0SE 0S N R e$Q  3[[@%Q ? cJ[ 0S@ lЍ, 00@P KJP e ee 0S0S0@ \ dKr  R0Sr 0Q@P $wN$J OPp 0Sm 0S  k$0Sp 0$Pp  0@T` ur0q p000PU! 0S 0@ R rP 00@m y뫢뾆0!000 $0NX #e K ;J+0 fHJ@000pj J%J_  0S00 r 0p 8X7سE- Mp`(@<P ZT000 0P@T Pd Ѝ/rP PT0P0P 0P/000p03PQ/S/0S/#-00MQЍ õP-(M0$0000 00000 0Ѝ0@-@M(P 0 P0  q p0 0P qp00P yqp00P oqp00P eqp0 0P [q p0$ 0P Qq$p$Ѝ00@-0CS@0 P )dP %dP !dP dP d P d$P d@dL0@-Q @PP cc@-@P 000P/冴 5@-@0S 㱴p@-PQ` @0S 000 /@P PppE=pPp 81wP/c0@-@@MP4P0$P000cЍ0 Pp@-` kPU piPU$@  9xpp@-`iPP p$@  $xpDp@-a0  SPp1p!0x h1h!@0 `1`!0 X1X!0 P1P!0 H1H!$0 @1@!,0| 818!408 010!<0\ (1(!L0P 1 !H0D 1!T0X 1!t0` 1!d0h 1!l0p 0 @(00 PAU@ 0SIi@0P  P3AU@0 10 !1pt2Ĵ̴Դܴ $,4<DLT\dlx0@-M@9P9p aPP xЍ0p0U@T @T 00P0PU06p@-`@>l?>>d?>>>>>>>>>>>>>>>T?>>>>>L?>4?$?? ?>>>> >(cw Ѝ3008pZ0W0#@Tmpk x sn i0X0%1K0Z0%`0Y05w0[0%3d + `'P2[\2@P2PP2 Pp{Py2Pu\s[qPo^0|@T0S Jst`Po IsAsXP  @om `wyyuuvvs <|P  ` ` ly`P? sr`} byP. ^xP   1`p0pS 0\  1W0S 80G`T { 1`M tm` lm f`? Pa`>$X^h^,606^ _^__p^|^^@-8@0S,0P  C= _@-@PQp0 ?Q \0PD0P0$p0 0 X_@-@PQp0 ?Q \0PD0P0$D0 0 X_0@-MPTP0@T 0P P (0P2/Ѝ006$+G-PM`P[ 0W `PK 0`G `PH 0E @TB  0 > V<  0 8 PT4P1PU: X-  0 ) 0 Z=P( @P 0 0ZY@@ P  0{0Y`P`Ѝ01 0^ @0Y8P  T$X0 ,806l_d_(j0@-,P@MP _00Ѝ0@}0@-hPhpP`M@ LhV 0S 0 T  c`Ѝppx_@-1Q M@ t6`l6p LP PP8 Ѝ040p6p$q@T? 0S4QTP)0 RT c6 0S00S#0T Q_@3AP A0`0 0`<PTx@P` ^^p0$ S  X$S S00S00^PCDP ^P,KP }^3P0 _O-3 M @R 1 Ѝ2`Q5]5p LP PP ``2 2R"@ QT 0 -R 7PP 0NPC n,2 R 0S hP hP 0P* p>P^"PQ ^  9@P |1 R 0S j Ts kn@DP]T P 4hh@P P 4\4XhPx >8NW VX0P 4]ALD_064  ___0//@-M@4P`44p pP vPY VPU  BЍ{4pP1pW@ VKUa 1 RA#h@P ~ji@ nPPK @ dTH D sfK]<;@P~o 0 0. 0>0K@ٷ``@PVP@pW 0"@PP 0@t@3Dŷ,D, n@ 0*f_06L_xQ(jT_@-@P  f@\@db0/40 /4P0 R D 000/404 Q  000000/4,@-@0 L0S ^P \ 0  0 R 0R/ iO-0M PRJ0pPPDpU0?@"!B`0 S hP0S`Ѝ00-M(0PЍ04-M0PЍ4-M0PЍ40@-8P@MP >\QihЍ00@-0 M PR @P (\00?KP 3i Ѝ@h@0S|0| pU` 0SoPP0 @h 0y, ЍD0 _hA-`pQpP$`V @U@0 0S [00TP0 0hW0NhP`0U0V0WA @DmW+-0M *B 0 Ѝ$+T0@- R 0S 8@800 ,@0@,$+ 4c,`@-@x22p-0@- M>oP +0 R 0 R 0S 0 06 a> Ѝ0@Ѝ/$+@E + $+8`@-( @cg@D`@-@ @T`@-@P ( @ @l`p`p@-`P@ | TP  p@T TP p@, @ @|``@-@ {@s갤@-@ q@i`@-@ g@_`G-PPMp `U 0 $8P( Q:0@Q@Pp0@SS/ US4 1PUЍ0pPU 0 7P1 R 1!Q 0p &+PP gPPh gPP8p STB 81@W4! ,+pAW @PST" UT* 0`S`X`V *Z p2AW0 S X RZ p 2pd gP 2@ gP 8 gPP,̚```@`@`x@-@ @`@-@ @ @-@ @a@-@ @܀@-@ }@u a@-@ s@k0a@-@ i@a꼀-PMЍ [Uȷ똬@-@PM" P" 0-S PЍ0S0-S@T 0 7P 0P(0P Pa)0@-0@ MPP@  R 0-S P 6P  Ѝ0 T w0S0-SPU  dO-04M@Pp(0,0U0@`0pJ 8 F0@+R( , 2S2b``````````````````````````b````b``b``````b`b`tb````z4Ѝ0007 0p7`V+ T$@@0"f0ep5PPL' P  G0 +S 0  0[%eP000S,@5P,@ 6PF ; UDY@P V, R (0 000X`V RA$0S000L000HW@E000A000=0009000200f bZ,@ Z  (0 d5U0SU- Q|X `  (0  lX$`$@`V 0sP 0@V`VT,[,@0 Y0 0S@ @T 0S  0S(T Pb(0S^ R 3 Rs'/Y$00$0UP(0 9[,@ 0@f Q00SyRGY,0 0})W-,@ ,@(0 W,QeF2E,j WPW$ ` $ [PP P @cPWW$0`0$0  0WPr 0 3("  XP ,000V 8^ Wa[00  @ WP @T/ dc@ `0 60Q060\W060` j=Y. =_O0 S)RP,Xd@@ (_`;.mTa(6p06@taa`a-<0M0S Ѝ ЍaO-2M 2RpE ZB bo9W 0Z 005 0@Ts 0Sp 0S 0S 0cAPU Z_ 0S@8:00CS0V 0pSTWg  (:0Z 000PWV 0 R` 0-S]0 0PU @` `P`U@ <bP0S U 0eS/ nS+ ES0S 0pW% 0 R 0-S `8 ' 0pS *"9P h08Ѝ<`8[  9pcn8afA-P;-@XF-pa@) PlllllllllllllllllllA @@@ A@q1 PR  @U . `# d 0`SPLq@ 0S 0    5  0PS@@``n&`@V0000S0 0  00|TxRPU 0$P0@y8G&|baL06bXD b-MP0 ,0P Xy ЍЍ06G-MpUPj 0f |UP_ 0Z \UPS 0 N <UPG 0$B UP+ 0(& `P(n/p" 1  4$ Q 8 /  Q-  8/ RPP0(0l`P1@ 匼T" ㆼ, {   , >P: \2P0Sj dR "l2\B 0L0C@0b/0 L G UP 00  Rd 0S6  RP^0SPPX0, P0|b/0 0 t1 "h1 nT0PsP3 0S 3 3R  0S l00 D3 R 3 RW 0SЍ, 0S_ ڭZN2 RE 2  2 Q 0 R 0 R 0  0 Q 0 Q 0 0S 0  @T 0 0S> @AP<P=ᕭ1!հ001 R1 Q 0 R 0 R 0 Q 0  0   0 @  0@00ᣰ01 R 0 R!0000p R 0 R 00C0W P jA@RON@g~R@db@0 t$d)b$|bp(j(+)@2d6/-(0MP @

%U@ Im*A(i*(@yIfx@-pM0@P@00?`D0 PЍ0@0[InVPU@-0M-S  -S+S@R@@ &PЍ 0 U Q8SP(0 PQP 0 pPffG-@PM0 0 pv p`00-S( +SCP M&P5 0 0 +R  `@T6 X0SL@0H0@S000S0PlSp cS vS pS -S  &P0pЍ 0S VVh@TSSV ~  @2  f0-,B +`PPY ;pQ H 0S@00CPoV`Z㜁W@* 0 e0`@P`V`Z`!`1@@W 0 < 7p  # #0 +## JU @TP D0 D(0 #w0 #fsff@`@f0@-M('@(('@P0Ѝ0gP@-@ @P @-PP M0@p+ p+ +T -TL&%PB 0PU 0  @-T0S0nSp -Spa0@_Q\P  ЍH S* +^+ -^= @qQ0G0CT00 0@Q0 }0e`0@_Q  l@d@1 0jP0 0C0mGTUP@`O-pP$My P @-Tg -TP`% +T -T-$Pv -TK 0OR0P$ЍE R`PU 0@-T0S00nS` -S S0QU @P  eTPp`BŸ 0RR 0 a00W#P|0OS  Q R0-SPU`@BP \VPFP@{0P 0 PT FPP !00CAPFs0pS,0#S`,1!0K0 0N @ P0|p 0 A0Q0  0n0@ P0@  P pF5uPrPP,dFP(,P 00e-UP9g 0S/00S0/d-0MЍ{h-MX@0 <0h 8 40(0 l Ѝxp|t0@-MP@* PЍ0@=O Ѝ0@艵O-= M p$,0 (4<@pJ a0@SвЭЭЭЭЭЭЭЭЭЭTЭDЭ8|(5Ѝ='#P P`V0OU0P1  <#P 0T40!  ><5 `, p`<X0$`D0,p 0S,0$0<0 VqU VK$`4P:(0S$PF (QDK9( :` V ; R] 9Wh@;hP+;0PP:h@:*0:@ ` ( 0R00: ``p `P@$ R" U 0S@ 00Z Q 0 S `F  (0 S0 `(Y$ R P 0 H"[P0@[@4Q( R$0SQ0Sx \9\ @ B @q@P !PL@ 80<08 "P 0T/S(0T T8 $ 48 880@0V PD @9Q 70S ",P" !XĞ(P5@5 R) &㵞PD R 80S    R R R5 RD 0S8 qpP> 0 Q ,PCU CD 0 :D 0R D0`u P 0 RPP j@P 00Q  0S000P'NP  P 0T40 4@㛲PP 媬 8q@P Qw j a,z0 3 R,Q !!`40#000 32 R0S0 VW$`<` x2 RP, RS !Q 4 D0Pt @0Sa0SS i@D0PhD 0HBU0 :0^, [(, @O0 z塝ib:!㒠1囝$Q 啝4nxu0S7 iD @KPB0:0BD0P 8gp0 R 8 @eD0彯PD 0 D KPzPlg,6@gg06gȑ 7|xDtTpd6lgd>+gh8 ܳ-M-M<0< 0S( Ѝ)+g)0eS L0 R /80 r3/ 0 R0 R/X0 0/t8--P<0PM,G$BЍ GKx @-X@-P00L0G0S 8 44K,BGB8آg̢--PM (0`Ѝ̷0 R tD2--PM 0 R 0vS `Ѝ0eSd0 R P00HY<0 R(00$0$XgO- M@ Xp fP vPF 8 Ѝ$p2 `yV A P @( 0   R% 0HW 0W `VG 0XP" l10Sp pP' ZAZ Fp Y* T` @`[Pp [}MpF ` 0Z  `[Fap8 qh06DhxhXhԤ< hE-衟$MP' `@P 0S^ 3/PP_PP  0R0 ]P 0S N00`PPgpQF `APQ 0PS OMM:00`QVF, 000AP00 #0@ @I 0S00S 00$ЍE@ 0 RP M0`0hA-餀pQ `@PPQ 0SLP"10 P0S 3/?]P0G-ࠟ pR ` @P PR 0SLP"10 @T  0S 3/& ]p -Y000p@-M`00&P@@P-ЍpP@- @L~@@P 0  ML@P ?h-Mm&< 0S   10 S!00ЍRQ,0,0   hQ +-biihhp@-0M PR`" @ 0S$ 3/u P  R P 00\Pu Q  RЍp  0E-`P MO $p ?P 2 "?Q Ѝ0P-XT X` +X-Xp\@TC ?TP oT@T! 0Q R -R +R P`P\p00@E<+WwPB@P K@?0 R B@P TK4?`V 0P-X@T -T -pv0S`)Z `+x\v+\VD46A-Rp` o?@TXB  0  ,!000?PP' 0$ P0 Kf^K` H0 6   0&S 0@&  00=>T ?@P 0S &    6` G @* pA-pQMP` 0S]0a0@0@0 f00B@0 i00B@0 r00B@0 t00B@0 x0@0B0P0V0S0 00BW>TB!V 1W  R6 1 R2 YЍWA h0SP T6 \1 T  0a00@@ 0C 0 f0@0B܀0ST P  0P'@ >0 $ T`0fS  $ $`@i$+i4i@-@0>P 0  808 Q (0Q 0,O-M@Pppa@ PxpDЍpa@2`V 2  [0 00=Pj [00  0000`VA 0XP\@P  E0+Sp p$P9 T# p=0p00C@0D0S7 0000HppFP0 0000&N=0S000D  ?`V0SA 0Sr00oT0 0000 0oP000  00 00 . @Z`  0Z00V^ P @0S0 0  h0h Q X0Q KP<>@`i06pii,  A-@10P` Q?_^V$1 R T0 @@v2 0P@`u P < 00Rp@T$@ 0I0I0$ 0 0%T0 ,@ZU4i+p@-P1PU Ap1 R91 RC1P 0@0hI0H`XT0S ;<N(1 RRA PQ@Ӗ0/@[HP @=0`PA P0AT x0 RIH@8岖@寖A06iL $id6/X-D0M R];$0 R =Ѝ?;0@-P M @P; Ѝ0000 [R P0S 9P$+@-M%pP H@P o Pi  c ]  `Ѝ@-0PMP& Pp %p)@`ST uT' 0 R  W W Ѝ@i;ST pHP  ЍT HPW0 4 , HP/ jx`jtA-@,P`6p lP pP] b)p`2V@kt3U00SJ0Xd 0S~<2 R]0SZ -S0SU ㉒pP 0S@F 0Sp -S= pT` `WB W6@T 0jpP6 WʏUD U> UX1 RK HzPP&T`*@@T 0Fp0`0SpA@T~ ^0`@@DT`nd0 R =P| pw p.0j06><G- P`p84 RKp>P|XJ p`Y Z P qX9 ptPTX5 Z3 @T8 0 Sj `3Pk /Z  @2:X pꢟ@P IXppᲉ@P] 0X/u:pA:@P SrX p {I p r| ~  ku  d m JFP* 0/S    @pSha`Xg@h<@( . 7 p9X @f@   # o   #@  9Z`piPC|o 8 ;t8 \jjjid`<j4jtjLjp@-`P@@_@T' 0 -R" PtR -R pR aR0R 0R 0R 0Sa00 a0C0@TPT$pP@: $P+$||||||||||||||||||||||||||||||||@v@31` pJAp0lPpP@`1@T@ `@T 0XP`00 P@PP00 P9EPkt00 t0C0d-EP (EPp00 p0C0StEPNa00 a0C0oHEPBp00 p0C0;j06 jjjXcP0 S 0S /l x1G- 0MPHPA P <1P ~00 0ЍP P#P -P# (P0#u0 #U0 [!e#{" % 5p ;,E | P 0(lG-@M``Q@P p0 R 0  00  tt X 100 ?ک i@Ѝu(  ljjkjO-4M0PSa00S 0CƟ 0 cB;0Q0B ;0C0lv0Sr `&@@`8p@?0@= "S",,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,, 0S@5 x5 0@ @rp@?0@@5V 4 YeP L0PS[ ( PG( `4Ѝ00|4h4 `P4Q/D4Rf000   0p 0$@`PTPp@ ⚼0*0S @C p M ( W <# 0p0W 0$3 0!0Z@X@Y T ( ^PT 0hSx sS uS! P 20 t2 P @?b pᠨTW Pa 4CP `p  00@TjPwP!!00S0v. 00  00SA= `p0`pS`pwP}`T  00P @C wUBP   `BPz "  (`0S0x 㼻 D 100P @KH0`0l,606(k kLkkTk @TP00ЍpA-@ P po0@ S(cXbD pPo0@ 02R@[ 0S T] < +P-P`0@P`TPPPPT) 1!p`0R+- b@T 0<p ! P`D0R  ,KRA ` A`0` "`  ``R x pP %10#`@ @P 0W  R  n06DrHrhhnp R0  /- 0@-@`M"0@PVSYxxx ,< TdtR \00Ѝ0 @00AS0r03\0T ! 0 00AS0 B f\0f00f00f00f0R00 f 0f0 0f0 0f0 0f0 0f0-p0  a0A \ SAAW A^7 A0 A20  a0A\ @ \00Lr@-@"'= @hr@-p M0S@P  P0"S'S@@  @0`0@ PR 0"S 0  Ѝ@_ @0P 0 0 -MQX0 Ѝ qP* 0 pE-Mp+=0 PU@x` ?0h`?00m DA  @A0S 00BBЍA-p0 00S@`Pᘀ5*T 0 A000 000  00$?0?00(O-RQ M   P%UPp-UPp;P*U 0 E0 SP00E S1   P0B00E S.Uy 0hZïjZ@ ppW ,2` 0P@`0R `0 1pWXđppnW P`0@1 0R0p1 pWZ! p@Mp0W 1` 0P@`0R `0 0p0W0P ЍXPѥPѵh.U0*S0  0 C0 S|00L S 1  0 B00L S0? R0ShfxrO-/o00TM0P0dp vP .HTЍ@?O  PF $/00p?0S<0 <00S40 \ <0@.000@\ 4pMPp\ \\@ %\ \0 @P0MN0X.Pf @P%Tg :P9 @T 0S]0 S]0 S-=PPO L 0@p0-OP N M<= 0PC*T 00H S00H S .X *XO -X 00H SM4$X @@T X I:P0 O0ED  @ 3Q񟗖PPPPPP \h˟ R  0"S'S@@bʿ @  P  ˟0@D0% 0$ ^SR7 D ^ 0OD0@P 0S :DP} Al:lJ-000 HJ-0000J0: 6,;0 0= 0S I9 6,Y0 SIY-000Y0 S|IO-000PɟDP 09eɟ@0D0 0$ MSgR_  0D 0OD0@P 0S2 +8PD-O0 P0j@P 0S PU  @T : 08P,ǟ0S 0'@@p@9t3TP \Z)P&  L\P D@8 F JT P0 k[00  0 @P< ,00 0S F6 5+V0 SF,000V0 SF,000TH5P@%0S 0DH H0 H0@S D00J@PX 0SU  pP ş 6M0OQ  h:|5@0D0 0$ S}Rt  D ş0S  @0"S'Spٝ 0@D0 0$ IS/R  D nL 0@ PN M Mb*0$ `[$TP3 R <0R 4>#uP#q 0D@$D 0 ' D 0DzۧD,GD0 R, 0"S 0 }2@§ (@0 DHD0 R(0"S@ l"0 `2  DnLŸ0@D0  0$ SR  0D-D 0&0S!000SeQ0 SZQ0 SO1P,yD 0 @ ,)80pD0  0$ SR D 0 0D D zD 0sD 0@k QQD 0ar,606xrrrrD @lT <@ k0@l0 00  0D$ D }0 0 0#0 2 @ 0+  00S PAP1 3)|Q0 SA*ppQ0 SA*pp. P9)1 #  "0080 k00@ c*0S PBP2 3)|R0 SBQ*000R0 SBG*000" P` 0S C3 T3`),c0 S4C%*000Pc0 STC*000} P  4C *000C*000C3 3,)D G DA 0D: 0D2-,0S0 100O-頢`嘲 M0P0 @P>Y p"0S2 0S\". P2p0@000"@5(2TP' 0S$ :XP  1R > 1 R 1 @ 0 ?P Ѝ1 0-S PP`0h!000-S20S0P0 D1(!100!0V000:S0 R 0S 0 00 0P0Q 1 0SPt0 R h0 l@尮 0L0, 00 :R:?0, rr$00 0/ 06G-0+SPPUP tC0PH hhh#0000-\ U0#00 +\ R -\4 2"`r0@2:Y120 00 R2  2Q ? ?\2 DP<4P-R0S 02  4P :P ;P #P5 000 R1  1 00 R 0!000\1h!Q" :P5  0-S U +S 0  000Q 00A S0 0f0S ;P" 0Q000 ? V Rp09 0yP 0 D0>(0  064(646,6O-M 04 0@  0 @ppD A0@5S5p(H&X(H&H&@(((H&H&H&H&H&H&H&H&(H&H&'H&H&H&''H&H&H&H&H&H&H&H&''''''t'H&H&h'\'H&H&H&&&H&&&H&&X&Ѝu@ p0@ p 0$0u@x@ R 0@00S  0@00S`2` P@@Q| 0S3PTs1 0 0@0 0y@y@{@|@|@ p@p@p@p@1!@l1p!@T1\!@<1H!@$14!@ 1 !@0 !@{ ذR `@P PQ 0S3PUt 21C0 @p\ 㙬DP4LT` GD[ Btts,6$ (,rrTO-PM @0@#4ß4S@00ß000s @@@@@@@3@P P 20S P 0S  HB0S  @:" 0`0 0P 0 34T2+30 0P 3)$2 300P 313!00P 31 300P 31200P 3l12P0 0P 3,12@$D 0@DPP 0S 0 $U 0S0(U@ 0S 0S @b  Ѝ0娠Spt @@ 0 @r@ںPZ P 1@ѺPQ $( ,064sdshUL2p@-P`l@ @@      @    P ]@\\ O%P R@80 D%P G@ 9%P <@ .%$P 1@ #% R  R tpttz `d w LTt 8Dq $4@n $@k h e  b  _  \  Y  V  S tP `M LtJ 8dG XXD DH@A 08> ( ;  8  5 2 / , ) & x|"sdt\thtltptttxt|tsssssssisss4ssssnnstttct<$t0t &f6j\@P ClB` A@3#0a ` 0 GH@H0 TH0ńϠBQl^@U ǏЍCgfff00@-0|0P@InA30a0XCL4L`31C01D}S^00 0/B0 0CMb@-M@   4/0"b31C0cЍ艈hvE-PMP 0S  ~ST @$,p`,㎻.0@p0` , ` 0.S% 0PS  00S0Q/S/000S0T Ѝ@P +p0/S`@\e)@P +OG+@PIp.0 @0 @xvp0@-lM@̚PP .P0: SlЍ0O-0M0@s 0/S[.p  /Sz 0 0 0/p RP /R@ .R) U /00 RR@ @  R/R RU0P0 0/S$ Ѝ0`0PP `@Q/Q00 .Q@Q/Q U!4PEY*0/S0/S  0 /R00S R  *;+⩺*[U/000  P0/S0/0S0 0~`0OP `P 0SO-MMP+@t T*me*` /R 0 0V!!%*f0  0S0C  00R /RPD .RQ 0Zw /0 @0 RRP 0h S7P S3  0R/RI *㷣pP~P* P*J@@D  */00**2 /RP9 ꐙ$00sqЍڍ0PS/S .S0PS/SZJ Q*0/S`ع`) /R j0/Sg0/0S00e @/Q 00 0VP!!%*0f  R  B0P 0/S0/0S0050S 0/S0/S 0 /R00S R  )(00p@-@P`2 0S /S!*rj)@PV UP t *0?Pp0P0p8PP  @ژ0v0@-M P@T P0s Ѝ0B'@P P0sPUx@@P @@PH00P400P$00@@8DvvvvxO-PM @ p )1U%,, 0 0-0AS00̕0ZPPe0Sd0`9h X@\0P0 '^p Ѝ1v@vD<+0@-M@PP@,0,@P Ѝ0፟ԥvO-@|MPᐸpJ )0TȐ`k9 X0P@00$,, 0 l00LS0 0Ε 〞P0S|Ѝ9'v@<+vDp@-PP`p0Sp@06/P@p0SpP/P E-PP Mp` ģ@ +0 0@V@00 ЍSPP/0S/P/Up@-PP`p0Sp@0V!0@SpO-`PM [ @TX PUU QV 0SS 0S^0SP 0SM  0SJ 0? U=00 00S 0SK ÷Yp0@'[000@ Sp QP 0S ॷYp '0@'[ 'Ѝ0S 0S ( 0S  ( (@-@P P 0SP00C0@-@PP @@-@PP000@-@M MTP@@00Ѝ03T 01 RO-pP00Q MY7P @0`0S '0' P U@ [0`A0Q0pS '0& ` V@0 00000 0 Ѝ A-PP$ P Q  `A0pS c'Ѷ0& `QR01 0@-PPM@ 0QЍ03T!0T0 @Ѝ0@KO-pPM* Q ZЍ Zp  A`0Q0S '|0s& ` V@ 01Q ЍO| P/1S/0P@-P@P@-@P@E-PMЍ0S ppPR1 `P @PU` ZXs@00PU`P 0S ЍE蕡 E-MP@ᚡ00Up 01 RT 1`0@TP X 0Pu&0%@TZ01PЍA-PiϵpP@ `@V&ĵ%@P`00@-@K0 @蚲` 0R/ %A-`P# @T pPPAT 0S~%P0 000S\O-M$M 0/S 00 R /R: 0 0CA0   /RR :0S /RR \0S IPu 00IP= :  @pRP` RP`PTN @ R R@ T Q 0S R< %P %P(@ R @%T @IP@I1* .Q# T&Q 0R S00/S|0vT $P @T$P@ 00C R$Ѝڍ 0S 0S0.S $P0.SxP 0S 0CuS|ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffR 0R=S :S r 0Sy/R/@-@$T R \ R 1@\00RR00p 00ꜘ@-@$T Q  0AtSwiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii^\00~ Q}00 0\  0@-M@#^TP \ @T@\\ P \00Ѝ00 @@ꜘ0@-@R0PM2"000S T "S:00000S0" 0 Ѝ00@-M@#"0TP0 Q dQ ! 0Q0"#\00QQ00p0" 0 Ѝ0蜘@-@z#'0T0 Q p Q 'Q 0\  p0' 0 0@-PPM @T @T 0  Ѝ0A-`Pp0S 4#ᡲ$0' 0 @pTPr 0DUSUHoPo@o8o0o(o oxnxnxnxnxnxnxnxnxnxnxnxnxnoxnxnxnxnxnxnxnxnxnxnxnoxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxnxno80  \001$#00 000 0P@T'00X 0g 0\00ErfvntabG-@P`0S `@0Pe 0Sb \S R "0BpPVSnpqqqqqpqqqqqqqqqq4s4s4s4s4s4s4sqqqqqqqpqqqqqq(sqqqqqqqqqqqqqqqqqqqqqqqqqqqssLsq(s@sqqqqqqqsqqqsqrqsq(r 0S00 0f0 \00  UU00 \00 0B00AS0RPPW ! 000AS0B P PP P{UPE0  aEp ^:\A0EW ES7 E0 EP20 aE pC 0   a0LSA LWLR7L0L2  }\pP  P PZ/cPPU 0  Pp { Px Pu Pr Po Pl^\00xPs P0 S !P"*˜0!P 0R 0 JE-pa MP@ŰT` 0  Q 00 RZ @ Ѝ @!O-`PAMM ᘖpP0: S Aߍٍ !3P☰⁍Hh %09\ ᨐ uPI@0: S   fPɍ@0: S  WP@0: S00 S h %0  , $0<0C0,@H"TD2D0 U4 Q zDP D0P@5 0.S   P*  P0 @9 x`0  00@\ 0$@ @ T @ @\ꁏp$00R,,hD,P Q @9ɍ9@0ɍ0 0ɍ 0 h 0+%|h '%' 40Sl` 0Shd 0SdH x0S`P0P]vvvvvvv@E-`QMp@P `   F>R10#?@0@d-0R`zyyyyyzy{yyyyy\{P@J00 Q0 W0#Q00=Q0>Q_0@00Ể@PPE V00VVSk  x0X00B0LBZ-00L Ѝ@000@0@ 0V0 t1Ba!00 0c#  A00 V0LA00L0A@000A0@ T000LT00Ba0!00c00Q0L@^00 00$B0@ | E 00~0 000S000L400!00c000LgfffwwvO-R M`P@0p4  J>Q! "?   @@00Q}|||||~|@~|||||X~-Pu`p@ ȟ 0S>R _   0 0@P`pG# Z00ZZS|  x0X00B0D@B R-00D  Ѝ@0`eP00 @0@ 0Z0 2 Ba!00 0c#  A00 Z0D@A00@D0AVNK 000D@ \11   %2>&BP0` @@@1>A P00 ` @@ 4 GI00笍0 0S | z  R#RW0 t=R0 pl00 l00S000D UVp 0O0  D 0H p\ 0E0  D 0>pgfffwwv@-0/S M`@8Pt@ Ѝ000LPP p 0& 0@s00R PU@@p@-M`@ P  l0P   BPЍp0@-0 M@pP P l DPP Q Ѝ0 QT00U000hT  -@Z@QLCM@M KT 00 (K K@KJPC=K0C4K K`K;PC K @─KVCKH 40KQ   K0QD 002AK,HJK 7)H*KKK G0 /00K*K0K0Kܖ X *K K⠀0Z@h KQ::K JK b"@X Knh6AK,H*K)H0JK CKK:K @K (*KK@@@夐 K@弐 KQ KHKK KÒP@BMKK0@D K 4K  A*K0P0+ KWAP 0.Sf KⴀXl  7:K@0PJK@Pd000 cAA K !/00  ! K⧒PX0S0S*K40 SJK00@S KP`UeP@  K*K0:K0 ePd! KU@:K`KJK*K@0`S*KP@`,0S 1.S KⴀXKⰐYK0S}*K0 SxK꼋@KT:KP@@*K0 @`S` K"QQ'V *K@PPP* JK@K℀P~ P K@ ]!0*K0@:KJKPKP@aPK@T W*K 傀@Pd K:K P6!K`*K  @h ,!/00D:KC@KBKC=Kܐ0Aⴀ0CB-K0 BYDK   JKԀ@0X 00K堐 P K@K@:K@0TKА娀Y`oJK@`X`i K`Q`cK `P`] *K0 `S`"00Z:K@0`T`TK T @1P_ K`Q`ExĨ,w xA-`P@p ᇒP@`TPpWdϊ0S ,0, (00 /X777| 0 /X|O-P@0 00 0 0 0 0 0 0 ,00`p 0 0 0@ 0P 0( `$0p4@87Px7`d700@- @RSQlc;c@c@-0SM@! 0 RP!Y P 0_7Ѝh0b;\0L P00ꏅ0   $Q;~>\x77740- MR$0 @ ЍNA77@-@GA0Sp@-P` @0 R V @@5TBp<0 0Z@0  77XO-00 0$MRp$Ѝ蜄P20S/ `pW:P0U1 @00   0aV 9 Up1 8G8;pW:Bτ0a4 00bZPpGpW:0 S c 0@P ᘎQ# ` @ZP 0 00B|P80T00ſE8pW:ᨏP ۍQAA77p X0Q- TK$0^0 Rk@`Pp@- 0S 0 R0  p0`0@f TlP h0 D 0 0 Cp?=   c P b HX@-@0S0 aRiR CR |@0S>80S`0 T0P 0880  0 %8L0@- RA404 4@0070507T@-@n30 d0@-0P MP@ 0 S S *T =T \T Ѝ0 0 S S0*T00 |80 E?p77Xd0@-/QM@P ?Q <Ѝ0HqHq-NQM nQSЍ_0@-\0PMQ@ J@ 00dPHIЍ0I,-00MQ @'4Ѝ$"47E-`0 0SMhp`p@00RP@j  01 Ѝ847p@-T`0SpHPP@ @0@1P 00@p<7O-İM0P ! p @ p  `A0 0Q  0P W0@  0 Ѝ70@-PPM @S0y80@T 0S00@TЍ0-<M0000 0\0Ѝ-MT! 1 0R40LD03 1 0 RЍD@-@0 0 0 00 \p@-I@0 0`Q` t 00CQhP ^00X0  0 0`p@G,P00e7TPD\XXA-@QP`@^I_IP `p0<0 ^R LW@0t<0 HI@II40 R (@P *G0057X4 O-`MFV8 p`FV@  pܠP I@ I%IpIP@ @ 0R PVW d0d \0\  ЍF:,0, $0$ XTDP7770@-@PMP h0h Q \0Q -P0 R T$@Ѝ0@Ѝ0@GЍ0pP0@-@PMP h0h Q \0Q P0 R T$@Ѝ0@mЍ0@FЍ0pP0@-0PM  0S:Ѝ0@0Sp rHPsHHl0@ R(T0T P0"rF",0@@]:WHLX777-00MP PЍF:H-00MP PЍ6:H@-@@F"($ 0 ! 0<0770@- QM@P' Q+ !Q+ Q 0 R TAQ Q Q }Px0 R 9C`0Ѝ0 Q92+3HA7p 0( 0Rp@-P`0S !@p@>h`, `0P LP@^ ̘~49k!$ 0<0p77HLX@-@_ 0 , T@@-@vP P@@-@MpT0@@00,0P<0:E0` 0W`0` :`` @3" 0P<0 ЍP 5PqPЍ@X77f@/Q/?Q?  R/1 R/M0@-M@P L0 <0 ,0 0Ѝ0@Ѝ/T0 /0S 1 Rx000S 1 RT00 0S 1 R0000S/1 R 00/lD0@-PM@yw0S 00 ᲁPЍ0@-(@P05P` -MPЍ0@-PM@āP 0 Ѝ0Bw0S A-`PUpP@ 00 0P00A` p@-MP P@/P ` v00PЍp TT0@-T0tMP4@P @  tЍ0 -0MぁЍ -0MvЍ$@-$@0S 00d0@-HPM@T 8E4C$S ב00Ѝ0dd0@-PM0SЍ0l0`d0@ RT0H'P<0  Ѝ0@7h $8$O-#M0HS Ѝ2匐3 LQPز R0S 2 RB  2 0!`pPD00'@00Q<0080 04000P`pD00@0 0<0 080 040 01  1 RL 5P eP\l1U @X1 @PH0@ S 0@000S R00000=  0P:L @P0 yP 0 R0 0 0P 0Z l0j6u0_SS00  =h tXl|(h$8$T`0 R T0 R!/D0 R @/00 R?/0 R! /DH@0@ -80,0, 0 Ll7@-M`@Vĕ0pP0  V0  Ѝx0@-PPM P @'PЍ0@ Ѝ0O-Q 0T~Sd 40S 3/40S 3/Pt4 R h4 R \42/@@o&Q T 0S 4 R 4 R 32/@@3 3 `PO &`P 3PU03 R^0.S pHcP 0.S `3 R (0 ~R i@fӑP00 S/R /00 Ѝ2 R7"0@SpEU P PVP 02 (BP 00BPP 0P00.S0S 1.S y@p0  1@0  0XvpUq  Pk|;y081@0  0 0y01P %0 .00 @0SdEЍO;꬀c@8P/00 S/R0/  b`"O@@xXT78\8Qp@-`$Q QP y 1 A~R }0PX(&P@$ 0Q# 0@0 R PbА0X 0@040 ~R00} B p'p@G-,ᯐ0`P 0 0p0 8/pP P UAA,{ `U  `hp@-P\@TU@`@ 5/P8  00p$ 0Sp@d78h@-hM@ vp 0: S/  S%  S# S@  S=  S|  S hЍwP*O-M0  P000S S5SL 0 e7 0S@P  P``p0 P0Sl2 Ro `B0St Z} 0[`ZpJ0J/ 0S, /S! )b^w @@0  0P00w0A^?0S /S0StNp1 0S 3/ S@ P⽏ P 0 0 S/R@D/00/000S ?@ ` T 0wЍ`0@p00v0 RP/@@ ZN0 SP /@@ $P\ĨTp@-P`0@00-0YPyP@0@0 P NPnP P P V T T QTqT @0'ppp0@-P@M0 P<@'T TEЍ0$`O-2M@  bP 0T  B 0S002 R #02@TS0CbP @ *ЍP`U@@@ T R@ P%/ 0 S  ! 0 0CS R0 Y Q0S1@P  1` p 0pW tP  P&  @`pPf0@S 0ScQ PdU㼀@@ jT@pPQЍO//t0 R d 00CY 4Pw@pPQ 0 U[P88$X8O-1M[P] P0`@000S 0SSpp`@ d0 N0S`@ppP@ 0PS` [P0`JPU  5/Ѝ00SV 4|0 p@ /l P/"40 L@ /`@H$lO-3s0MS` 3/P "0S V P X 0'S 0@\T R{ 0 0R  `)uPP20S7 PU 0 s 30S00S1PUS 20SJ Z 3/PJ GPE 1Ph ?Pd 00cS@_ڜ1P 2P1000- KPtP<1 R 0PCU P @P 00SZ 3/PJP P@ S R@Ѝ0P 'T00 @~ "T @ @xP04 0SU  y@t7xXp pO-2M 2 R P |P Vl2l"```%`T2TP L2UHrHHPR ```e 0$B 03$ 0P[1P qP-P Q`P L1``Ѝl1`0S  1S  p*eP_!e`PY0@0U f^0@0lЍ*  'ffZS P[ `R Y TAX P v~ q0[00* V @ P000S0PES S S #S0 @0V0 K00_^@0 S P Pd0 S PU ~ /G^@D^@$( ,O-\0@MT M<<<PPp`@Vp`PЍd($,-PM 0SLCP <Ѝ<Ѝ$0PQP @-@0@-rM@P Ѝ0@-@P P P @@-`QM@, 0pP2P 0,0  \0 `E+`Q0i |0 VЍl[+`Q0 ,0R$` `( `0 X@D7<7A-`PP 0S)p!}U(0 P0@'0C HV P X>PLD04 1P 0Tp!ꨋfG-PQ7 Qd7P \7P T7P0D0 U0D0 U0D0 U0D0D@dEP T dP6 R DPPʀP dDPH0S I0S 0S EDDElDx  @R 5 0 0RPP SPR 0S) P pj 0.6P 00Q@PX@D   $0@D0$00P0$00p P8- M  08 Ѝp@-P|Uڀ`@@ -Tp\0\  B0Q 04 000p] 000p$dXH1O- R1MPPp@_P1Q, `T" _P!1 R V  f0Sx1 R l1 Q`1X!a800@T'`Ѝ Ve 1` P1 `e S_P0 RP[ @ 78T`f`Tᔀ P@塾T`T0L 8WL @ @␾T`\X,p  P8L8|08$A-QP 0 R `00w 000@p0!`V0@00 R 01 |0 cP L`@ @P0 @8P0`0S>`X$Hxd P8O- MP аP 0  崀0  0圠 00p嘐@0 P`@|0| P`@08 8 ,0 ЍDXLHTP$\`0 8@p@-AMP3 !e71 0P 4 [70 RP `RP! @B 0@0 P j0`Ѝp@yLP` 0PЍp@@0L8|(8X\T@ 08P8@-8@80 00R Q000h,TO-P!@ MP 8P ((q((1$!PTPPPPPPP 0S Ѝ `P  0K0p  0@PP@p @P 0h 0 0 .( P`0 0 080@ $-@-@M 0  ڽ0 R @|@|| |0@t0t P X0X Ѝ@Ѝ/l40 DT@ 08h@-@ T00aP P ]0  0 Rh@-0@SM@1 R4 p`TʀP00 T00S᧼嬭ЍT 03`?@ 0+U`@@T@]0   ]0A p$ 0@`h$(@-DqM0PS) 0a0PU 1`@e  0 \0 p`V Ѝ@0P000QuMu`0Sbut0^ud@d0,  UuPP0Pu0Lu0( ``ldx|tpp@-tad1@`1T@)L1%@ P@P\P1Q, 1P1!0Q@@H0U&mIQ 0 0U1 P0 p {D0\,804 0 ,dlp X P8\`xT(O-\M `ဠ4\P? Rx ?ϟ ?R?00 c0Rq \PH?@T" VP R 0SP  00R  0R!0PQ(4P$`,%Z PP 9P(P4P`0V R0 0S  V($a,, Z(0S p 0S  Rp(W00U00Sc \Ѝ ͟ 0R= R = Rp} 0 @R[P#H=@TT=  P @@<@[<0 T.0SPlPW TPSU,@ @T0 00<@ < l[ <0T PXB 0S]@0  N1R[P<@T (H`G UP1V* X0WS P 0S( RK`F UQ1:Y@P R;00 0 0p; Rb [P H; RY P[<; R,0000;P ; R+k0S' ; R#ʟ00PSZPn: Rj: 0Rڼ*3ZP`:Q \*P0:ZP0: RL*(ʟ0S|:  ( 0$ 0c,0( W00 9RP 04$ 0`acZP9 R} P \9 RlI 0P ZP<9 R~0 0aPZ$0P`c9 Rg U 9 0\M 9 RA U;(0!Q0S8 0Sc 8 R 0SUgZPC d8 R?8Pq  6h(J3( -,ȟ000 iQ(0 @! ee08 R('000zS0, cJ@0 `EP`v, `? VH@L@P@D@a V0 R @Pp(0S D 0L00P  *0 @Pl 000p0V(4P  b$,  0~0P0S40S@ 0 c/ `/( ` UR1@*0 S ~/  x/0(` U\1r*0 @clD 0LDHLP<0 P ZPQ6 @eT35 R ğ0S4 r U 0T4P 0S0S T PP$W2UQ(6 ({@$0V((ğ000JYP`a `f 3PU^@ Y`P| 3 0R Ss(p0kP(4P0>Y 3 0ᨥ0 0Pb@3 0SY YP 2 R 0 s 3Y Rw(000>(0l$0,@2P 0Seb0S 0S @@h"1T( t2Py 0Sv ,"1rP0 , $0(04P0 XP10SQ @ Z  0 0R  P P(XP810S  b .0X1  ( \000- n1 1P 0 000 0SG 0S0B l . @+P,$(4P0 48 >1p \P8X( LpL8 @|` 848T8 8H8 80$,X0 喷0$0 0 0S 0S0P 5|0 0b0 +(  b$, 1@!O-?4M RR O0S?00S> 0S: ? 0R/0h?0 0 `Lϟ\ 0PSD00 R8h>PW@x@ @T  xΟ0P<> =-@=0@Sp Z4.00^0 1aWP= R ͟0`c0V @=NWP=\ @@PMP0ZPPw,͟0 P:WP`= R 0S Qf ,wPLp0W0Zd̟0ESl< R U U Uʀ @^0̟0 0S`@ @0BXp̟$0 a@Uʀ~W@P0   y  $,0Sʐ; @0BX 0 0@1VP; R/ ``K0Z P0ʟ 0 R 00BSZX[1 ʟ0 Ri:0Se 0Sb 0S 0S J0 S.X|`hp`-$JZ 0@*Y0 Pa00 b =V 0lJ0 S+ VX4ZHʟ00  c9 ` V6 0)V:p@ @0!4  P0 090SZ Z09)8IT9` 0)pCWPfgC\OA Uw^@@BVTT@T P<00ȟ0 D [ >0 0B0S p0ST4 (W0 8PTP0 PTT8 b8X0R[9 WT ( 0d0aS07xQ @!0 000uSP1 R0SQ !Q2 W `0 ?#; +"+ cˌ b," k@2\Rk XRd 0Rڰ2 [;SP 2 R aP 0SVA0`S@40 Pr0V0t3 0Sl SP x3 Rc @TSP0003 @P'ڰS0SRP3 R 0R(T0S 44P D$+ RPL4Q H$@TTpD 0|R\`0QPf 0UkRP4 RK 4 U  k05%^@tPP0@ aPf?#; +"+ cˌ5 b jj R0!jRP5 R> 0C P0$Fa Pf@6  lLL0 `PfGRPl6Q @lTd 6@&F S0@cF0 0a ' ?&0cO-M\P00Ѝ0@-0M R P0S 0 R @0S Ѝ0e @e00@e 6e| 2ep .ed *eX &eL "e 8e00h lDp,-M00S 3/7Ѝ@-PGM20`@P0phefe  d00U  Gߍ0Sp@-M`@PLe P Ѝp d0@-AM0S Q0S Q@T. 1 R A0S Ѝ0!00teh-e\*eP'eD$e8!e,e$e0 S e d @   uP P 0 | l 0X 0mdL Zd Uddh lDdp,-$0M R 02/Ѝjl0@-@@M0P90 (00S3/090Ѝ0Dp@-`P0M9P0  |00S d d d2>d   @ d090Ѝp p0@ P/0@/@-@)i@ @-@TQ 0#4@-@TQ 0#5@-@TQ 04@-@T@ P0   P0A@-@T@ P0   P0A 0R/ E-M`P]Up@U `  @P0dЍP0p@-``@fh 0 P00pXL1L!A-@pL\8@ ~Q Q Q W w 0RpG S S Bp `0` S S  T S S~Q`F T~Q@g@lh P009'@ ,0 ~R)' 77Xp@-<@`0P ,P<0"h0Sp@\X-M( Ѝ@-# L@wG@ 0R:0 )0S0  b86@-@YP$0P0P0S@-@ D0P80PO0  /A-PpU` @@T@T" -@P 0S h0 `0 R 8,,7X@`0p@- 0@RP 00@0 ` 0S 0 0p030p $0p030pp`0STX T 0@0c00 0S,(000Ș x@-<@0S 00; (0 O70 A-Q 0Q 0P p开0Q@`TJP 0 0Q  P00CS< 000C`0D7XO-霑M0S3PUS x1@ TB @@f `D0q10S' 41 Rq" 0Pn@k@f[@uIG0@ 0尠 0`B qRq00`ЍX+0   0 Q0( 00f`pPX@-t`tP0MQ@ Tp 0S{, 000Ѝ?77A-t`tPQ@p  00b p[ 00 p770Pc0PcPp@-`P @V. 000p@-@@P 0 R07X7,p@-`VD 1P@PDP1: 0R 0^RN \ \ B /\ ^ \ \00/\00S  R R00/R00S N^ \LP*00 R0 pp7XX70@-MPU8 0P@NP": R 0 S S BR 0\L S S 0 S S0\L S S  BR P*O80 R Ѝ00 z7XX7@-}(0@ 0@40@d7770@-0PMLP@ Q  00 @R 0@Ѝ0cЍ0@7X70@-0PMLP@K Q 00 R  0 Ѝ0cЍ0@7X7p@-000` @T@P@p770@-PMPP@T 00 @R 0@Ѝ0Ѝ0@7X70@-PM`P@T T 80 R ,0 Ѝ0Ѝ0@7X780\\ 0S//O-ㄡMP$ la dq(0\0 ,\ Ԥt̤X8 H@P0 0P(XЍ k 00 0 y y { {x0h0\0T0v@08 077@-@P@T PW@-D@0S 0S(0Q 0 BX77p@-xP`V @X0@T 0 S  $0@T0 0p@w@-pMP@`d Ѝ-M 00Ѝ- 0M 00C0Ѝ- 0M 000ЍP0p@-P`P` -@0  0p0@-@M0P P [c  Ѝ0p@-@P` `0PV0 P@T00p`- Mc$$0$ 0Ѝ@-@ 0 @0+ p@-P`0S x 0:V@ vcn@Tpa,0 0C0 p1 0@-h@M0P  T0T P0 Bb0E:0Ѝ0@Ѝ08 0@-p@M0 `0 RX0  PPP +c#0:0Ѝ0 0@-d@MP 00HPH0D @P@@ ,0, @* @Ѝ0 @-d@P nT0LP00 0`0S 0;00@-PM R |@0P 0P R@Ѝ0400@ H 0Sp@-x@x0 0S`dP\PP 00b0 `0 0p00b 0 Q/$0$ 0 S0c0bcC/-H0H R000 P00@-@P( 00CS000 0@0 Q/ 0P0/@-@PtL0L H(@ 80 , P00D0 ( /D 080/D0@- M@PP A P P_ IP Ѝ0U믡P0 @-0EMD000  0S |0Cp``0S0 # > @H0P@ @  Bύ0 QaLPEߍ 0@-Mi@PdЍ0O-2 0 SIM  1IߍP\0S FP<@Tz(A@p0  0S |0C ``0S " > @1P@ @ 0Cύ Q a]LP#@t@`E/ LpPA TD1TP@Au/ 10Cs1 1@ T T0S0S  H@+HG 2H HAt T1S  nFPi$00 b8D7 TE-@ MpPXPP` 0@00:0V@0P0 P0 00p@`  ЍE- MQ`    pڄ@p PpW 0@00 p@0  p0ЍPp@- M@0p 0'`P`@ h0!0 S H0R PP00t  ЍTDP/@-@ h`  @ XX-0 SH0'M  000S 3/ЍЍ 8-M+<0S 00  Q 01/'Ѝi l@-M2 R Bb/ZPR0|  CR0Sh b3/P@Ud |bPUpr0S d2 RP42  Ѝ42 PR 2@0S 3/RH00A1 Q.0S0S aط0S@0 PT1  l1P 0 0S@1 1 t,@P 3Pַ0P 00Sg 00 P0;SY 0 d0P04b/$~\ 0TA [886(  $ 7PD X`<@`8 @-@ 0@70@ 8P0  Q 0  /X8P8T0-\@0PQ ^( 0 ^  |\P (0P/ 0P/ | $0 R/0P/ o  |t0@- R`00S S D0P8@lՖ O(l  |-0M 㼥Ѝ7p@-l`P0S P@@D 0TpP,`@@垥Tp@8|70唥7 0&7h0A- R pP`@1 P0S@P T0 Ќ0@-0@MP|2p0p.h0h*`0`&X0X"P0PH0HPЍ0 T      A-MP IP@`@`U1 R$1qT@`O0lAS10XQSP000HAS00z01 R0 !0C00Ѝp000P  \0Sʴ0T@ 0@SU V`ʔ0 R l0xP  \0SU@ 40 R 0v T P8X8 <8$ \XG-PM ,4@$$4$$P :4$4T@QcSo P >P :C3 R#3`KڨS0 SH 0ß3# 3#|3|#t3t#l3l#d3d#\3\#T3T#L3L#D3D#<3<#434#,3,#$3$#3#3#ЍxR 0S0SO0 0 (b0Sx R0Sx 00Pڄb@pP0@PU@2 82Q 2!2!1Qp!81 oP"<1 PAP\0 RH0 0$0 0gЍ@77Xp @-pPMLH 8Q0S0a B0@CPT@XAP0 R @P 0S 0@CP T@ 7APl0 R @PpW 0SЍgЍ@?7Xp O-\2$M`@40JS82pT0p`@@@V)@@P1 R! jP Z P @P 1 R03U PU$ P0PW`T1p$ЍD1 0[PPPULA0   2A0QBA0   A0Q f0HU @iMPP @ P 0 00B LJ@LP 7J7Xp `^\0- 0RM 0 0Q00 %Q  0 R d0 RX0 R \0 RЍ3v80P0 777(XT(xp@-,A`0@000 @0PP0- 0A0CS0p@P0 R$ p @P0 R ppp@0   k@01p -M r,0;S0 ЍXH-40M R Ѝ#} 0 Hp@-`PD0@ P 40>(0V@ p@\X7A-pP`0Q`P_n0@e0dUက x0   dRL0P  000d 0 }7X0@-PM@T 0  0R S S 0R B S S@DT@0Qp 0 S S  0 S SQT @0S 0 Ѝ07X7@-0PM'Q@TA SpЍ0`V?P 0pW# 0 B  pe0@ T cЍ@"?0   h0 R &80 Bk7p X7X@-PPMp-`0@ T3 U>P0 R h@Ѝl0 R>Pd0 R 0eЍ@u40 0#77p X<0@-@\ $0 \ @@77<0@-@\ $0 \ @@A77E-`PM 0S@ЍpP !0P@0P0P쀟 䀟0 @ 0AS 0 R W0 R 0S  00 0 00 0n0Q00cS007\7XE-PM< hq0S: \A0S6ژ 0S@: @>P,1 R+ 00CPc0VU`0 0 0P0@@< 0)gXЍW`0 0=PD0 R 0,C 77Xp O- M0PP@0 Ѝ1`-pV00W[f Pb@ `p ᄹႹ 0070@-M0 @0T@Q PP t 0 S X0 Ѝ0 P 07X7O-@P,Mb4=P 2PU, 0p0`2 GRS WC eUVP@ @ V W@K00pW1@p,Ѝ1ȁpġW@pѸA`  0 p3 pJ P>00C0PPP<P (1PU$ @P' @ _UU` @ @ U 0@@@Hĸ@?0@P&&'@7  ( 0P!PCt00C  0PPPfp     G-ࠟP`Y0 PpĀ@!l0 @TpU t0@ T %@0@p00 R 7X7-0PM P0 R D0 RЍЍcЍVЍ7\ p@-<@`0@000P@00ڼp@0@-XPM0@ 5<0< 80 Ѝ00Ѝ0@$ 4 0 0 PA-`PMP/;P0 R# u뤀p@;P0 R 0@R TQЍ Z 0@R  _Lp 770 R w\p@-@`P<0`4@$p7- MP 0S /4 P* 0S' CS' PS* 0 0ЍP 0SP 0S 4d0P4 P0S,P긣plḥ<$0$ 0 /``8d0 R 0 r 0|0R P P/0X Q/80840P(0( Q/0 (77X7T0/\-,0  M 0 ЍXT-P0MQ P Ѝ 0 \0@-M@0PP$Ѝ0X@-@80000,@,0\ X777@-``MpW Ѝ BS<@P;S30  p4 X@-9P L@ 0R 80  @噶P ᓶX@-@PP P @聶@-@P 004 @-T@P 80 ,0 $0 4 77@-@P0s P @TeD0Q80 Rd@0 Q(770@-@PM! 0s ZwPP @TP6Ѝ0\0Q P0 RUdЍ0@0 Q(77@-@j@-ME[wЍ@-@TP T004 -MV{ЍX- P0MR @0@ B$ 0;0Ѝ`@B`8< <0@-00@,0@000@00d`p@-a1 P0Q 1R= 00 C RA0S0!001  p-S. \1  H1 R40S 0A>0;0姩0 1@T0 P0 0000 R 0000p \ 010@000@@00\0;0p@gT``87d0@-M@`X P0 00?8 0;0wЍ0`P`8-M&P @P 80PP(0  Ѝ?`8-M0 + Ѝ`8-M000 !  ЍЍ`@-@L0 (@00$ $0$0 `8d` <0@-0 (0 @ 0@  8 p8d8@ <  0 /d8p80/p8D 0P00à?,0 R$0  / /d88 p80/8 000 0P/00S/p8d88  P/ 0@0/p88 ((0 Q 00/p8d88 H0H a0? P00S/00S/,d88 pp@-P@p0Pp^p0QpPPp0S p^p ` R \ 0Sp``@Vp1@pd88 P-T P\ @0Q 1  0 P0 0L0d88 $0S00  b /< l80/< 0@-MJPH0H D0@< <0^ 00P0 0Ѝ0< p8d8@ 8 @-\0M0S PU p`@P@U`Ѝ`8 E-pPM`Ѝh0 W PTP@0aOO0Ad88 p@-@ `OTP tOڿ@0@0`p0@-@PM PP ]Oÿ0 @Ѝ0@-@P P 7P 3@0@-XpM0S H`P0A P0R00 Ѝd88 p8A-o0S$PfUp ڜp@0@T |0V 0 0f1 01 R 00$0 0``d88 ,< h8l8T T0 100@-P@MP ˲޿LODЍ0d88 @-x1DM PRha `a`1 Q3 PQ& 0AS,A4q@ 000!0? ; ᱿O 0  ' 10 ! @DЍ200Op00Q |p0P 7P 0Q0H 000(p200N< d8l8@ 8 čD ,P P $ 0S / MD  0S'S 0 S'S /E-PMU@pЍ_P` @WP  U00$R0S <R @0-S <S@&R3 >R6 (R8 $U4P8 @PpU 0V U` V P`@PpU \U0 R 'V @  P <U>U@&U@<U>U $U @`̍Ѝ؍8O-RqM00 pP ` 00 P P`P Ѝ1` R [V`$ 0S  QR00Q @bN P/00 Q 1P  M\0PU `Q 0@`Q ፽PD 8 A-`pPaS0M@ :0 0 ⱽ8000(0 00 4H܍O-pM@PP! 0S` ``1ST0D@W0Gp$T@F$WpFZW V@@TЍ?O W!1 @@Z^M0@0pP@ Zp 00  HM@O-MP    0 `S pZ SX @ 0\S+ @0`Sp S 4P(1 R  P0D@@0`SpZ00[P 0 S000Ѝ0 R@jLZࠣ  Q \\0 RQ 80Q0 @0p O-$Ml4 0pS  $ЍP S -UP 00E  SB?UP  U `[0 U UC :UA 3P GP90 S5 S3 [ ?S/ `PU) 3P@30S@ 00 n P0F` 1   P0B00E S0\P@hYLTp0[0 0?S0``0S \BPU ᾯѼ?L7p,,P  c  P`@T0DR 08/@P001 啯P1!00@GPDt1U ` 7 LQP {PpP u  PrP00p Rq@c @R0P 1@X@PRp 0 JFp0h 0 `aK p`e40 0 00l p ` +p8+d8,d O-TMP` 0<`@`K (@HT^ L@PT <>P MDHPMD`NO`pWj H0:P %Pa *P] $Pn -P@s ^Pd 00@ S   R0@0@1  00@ S0@B^P^P*PQ$$Q00Q0SHQL05#TPxpHP 2P< R H0S  0 S"R'R HNpHV0 H0S H@pTLP`HPV, ᚻK<@T Ts ᎻJrHP$4P 0:Sz aRgRP0 0HP&0BRSR@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ <@ @ @  H0  ( 0$0$TЍx0HP 0PHP0:S PEQHP qQ! xR cJ [@ ٭ P (O έ0( H00 /㬻P# @ԺBJ:@ ḭHP .㚻P 00HPHPq $HP$ /㈻PHP .ほ@P sR HPPHPd(@T ៺T0p00@,p00, W00S` 0`S S S   S S`0pS  ),PU! '0 S 'p00Z0S\HPGRP HP ᫺P@@e @I  6P ߺ6 a g׺  0S 0Q -,p@00Cp#@I္-P0 H@ @P; 5rTHPHP0S0P5`V! HP0`şHpP 0HP@P$ lP ̬@\P ƬD 0&P) ş 0P9I0`Sp p@ \S Wx0  p0@S 0&S 0Up4 pP)@$ HPm@P I,4@@  @P HP[3@00@ S 1  0B00@ S$Q00HPHx3@`$P00@O[P 0S"  S r 0S 'S S S(H(ZPH`0 &R@yH'0[@0( P%  P ^ P 'P  P P0^0 0\  |H'0@00' 0  00`pU0PIH`HH 04(֫ ԫ $ 4H 0|0(ȫ ƫ$ X@H<@ H 1PHPHP 0`ؐ0S@P 0S 0000H G (哫0$0H 0;(凫 $ ꘸H咸h0L p d X P \ T ` O-QTM0c L@Tb  G@@s$9  Q Q`<@@@L@<  \T"W`L``0L`S0 8/P8 RE 8L`@PTp@ 0T@Z t T@ Zl80S "Tj ZHS 'TN \T'W R `0L`S 0RH !Gᇷ 0TЍG| 0L<sPL`0F`L`W l7PX70S 3/P L`S V UQ 7P  0`SL` 0`SL```B0``$` ` 0B SD p00 0L0 0QL0* Rp.P,6 Rw &0S0 6 RB 'W \W "W 0A SL0 0  0L0 0QL0 0R uQ0k 0R0g@  FL`0Q" <5呶P 0BY0 00 0L`VW  0SQM 0AY 0 00 0H D0PPD@T 0S000*H`UPPPL`u0P@,,0004080P0 P <@0<0p@L0 `L`T P@g 0 PSd z}3+P 0fvF LDkD@ 0 SP e_Dީ L - Y  0: S +@ lЍ0@0U +/$0@0*$@*DP<  +@|+T70CWX!*1WX *0 SA0 SpG$@_+X*0X *0 A S0 S PX :@ΧD+@ #@ 8-*p`  h b{+1+@D O-tMP"*`PT 6*pN 8@0U #0p0@V+X ᑧW ፧tЍ*Ppg  +P*  `* R0#03Y0Z Sp0 P1p0V00 W0S 0Q S0 Sppj#@T@0V&PVP 0U@ S EP*0U S 0C0E 00EQ l0 RpG kY NpZX @3#00|D  ^O-q`PMP@Ѝ0S A0S U  QUZ RPC@@ O["  1 YAX9 [ @PJY 00@DtJ 0 S  7PP UPE00iS0Y 0 @ 00@T 0 S PY 0R [P @  Pp8d8 | z@-M@`Ppp@ @Ѝ@-@ aRT 0R  0S\p@-`0M@PT` Ѝpf0@U e 0@@ݻ@p p O-@M@@pMW*W$W&PWP0 e ⺻0S0@`@00T [ TPPWЍA-P@UpPU` `P``UfT0  0ST0`00  ieG-PRM   Op! `V# @ٲ 0  U0S0`PE00P X`PEUX @Ѝ P PU@ᳲ  0.@PP нP`@ᠲ 0 0@s@0@-MP@ᑲU 0 p p Ѝ0 U000G-`p @P P$PT  0RT  0R  0R\@-pPM 0S PBA@ᥱЍP6`3AV@ ᔱ@-@PMP< 0~S AЍ@胱0/SS\cP:  Ѝ@ zA0`S/SP@  P@ 0P0 S/S00 RP  PҤЍ2/pP  PĤ¤`00S 3/pP  |PᱤU±0A(Pꈃt x O-~MӰP ᰱA ᨱ0"~SS00y Yv P@P0S p `@x@Tu ሱP ۱P0E P @  0RZ0   n!Ppc0/S `^ W. @TP)@T& X ᬱP 0& @  @00P.A 0R -0 ࡰ0S 0`/S 0 0Ѝ  0R P @0 00i@  R{ @ P0  Z@n@O<@ 0P0/`O-1M @R1 RЍ1刱1]T 0X }TT )T (SJ`p PVPp X Jz`F W 0VSp 0PW0VT YHZ0 0S`pxR0QP@q@t0@ @ L0刀  0*@{[\7X `-PM hh )´XX ]㾴HH }Ѝ临80 )㴴( ]㰴 }Ѝ䪴5D\ \ :\0 S 0R//-,0MP 0P:SЍ @-81MPp61`\0 00@ SP P00E00 @0 RP.P) *PP @7/P }?V?A3c 20?RcUt`@@7/TЍ0@8SD0(Bg` 00EPPc|8x8MbQ|  0 S R R \R \ R /:R|R00#/-M  c&<똎@-ը@P 0@-@PMP& QH 0SQ :S SN ^S \S  0S :S S ^S0?S   0S0U000Ѝ00 AR0/S 7S !00C/Q 7Q!00A0 @0A?SP 00@ S R  0S :S SdȎ@0 @-@0P0S=S~S@ @-雩@P rO-Pl4$M` ~@P 0S /SP 8~ uPP PD /%P U  R0pS U00 d R @@ 0@.P`PUP0S SS   0S SSQ%ZW 0g`c Pc f J%0`p30[@}0h pP`ZP0U\S 0#Sg P 0S S^ :S\ @0@S SU :SS |SP0 S n R0  0b 00? 0a0 0R  R \R  R AR  @@$P\ $50S  ` 0 ZR $! R $ЍP|zPP` Q@ 冭U+  \  -@0M0PЍ0S#S Ѝ(< -M  $:똎O-MD 0P` 0U Pp( @P  i(P0iP`0Sh %S00@%0CMSF0B0B0B0B0BD0B0BD0B0B0BPEE0B0B0B0B0B0B0B0B0B0BF0B0B0B\FDF0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0B0BFF0B4IIIIIIIII@I4IIIIIIIIIIIIIIIIIIII@I4IIIIIIIIIIIIIIIIIIIIIIIIIII\IHIIR0S!0C/0(S/0S 00 @-M@"Pa  p[ 0 S!0CX  <S>JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJQ00(S@㟞Ѝ0S 00:@@A-M`}"P,᛫ p p PU0 !R \R!1!0 R1@@ 0@@@]ЍV  0S \S000 SR 00O-tMT`P& Q P`  pP0: S `QtЍ@7ᙥP O /0 0p 0 S/RQ  1S0>PP8 Pp6 0@p0p0P@0* (P  j[ /00 a  ] P0: S@/00 0000P @PὝ-lM 6 P0: SlЍ -LMPP 0STPM1APPͣP;  `0P£P' 0PS  10Q 0Z1 V@r`T Vk(Kf V@a`V ZZ`Vx0Sl4PP CPM@PQ P J 0$`0($S00Q0 00 4` ` R0 00 #0S3pWMP  !PU 0K @P 4K pu= `#0S500.S6 \S 4 0.S00S .S+0@s@3(S8Pp "` PV`` @^Tx 01H40 .Rr 0@P ̜4P ȜT<"0S10.S \Sl 0.Sm @  P 2 RMҭ1 ҃qѠ Zpḩ٢PWP `ᮩ ҭ0`00 a0.S0.S \SY0.SVE-@ /00 KP*hM11 ` @ 00.S \S @0.@S@@0.S0S .S0S 0.S:n=; ` @ᨠ Zd 8O-@MbP PP/ P ` Pp PT  K0 /S/0C0000 0SX_ (3X Qp@P  PPQ 2Q#  @Q 1Sa`PH RF 10F  PR001қ@QP @ɛPě6@Tk WD Ἓ0  @PA 1T>  h 0`S ᨛV P @᠛Pᛛ 0[00S3h0S,\1 R%`Ѝpd⽡P  Ử0P 0\ u  0S` m` i]\`% _ \`X Vd` ̢0P P`სP  ၬ 0S@ >@8xPQ//PQ/ A-0S P(@ Pp`S Q7R@0 [S8 (S )S, S]S 05 3:|S 0U W 0PS0p V0PE`0U0@0000|X00S0UT0@DU 0.S:S =Sp0P^S!S``0A-S P(@ Pp`S Q7R@0 [S8 (S )S, S]S 05 3:|S 0U W 0S0p V0PE`0U0@0000|X00S0UT0@DU 0.S:Sp =Sp0P^S!S``O-p MW2  `0`0S .S 0 ]R0@T P@T 0W  P0SpXp0Sp Ѝ `hP- 0 HphO-RP R!!*` ,Y@5 ,0 RppڅS 0(S ?T4 *T/ Y 0S[:Zw `  0/S[Tp \T [ `0\P Y R <Ѝ0  @[Q `.W00 `?V  *V0 P ` /W00 S,^U3 `?V  *V0v /W00 S 0(S R W   Rpڅp 0(S0Z* @T ` 0PP@ ZW `.W00. Z ` 0Z/S pY p  |@^T!T$@ [T`* P` 00#p\T  R PUi `Y`Tn Y@e`0/T00S[-T  0bS0eS_]T/ `[T0=Sm :S .S44 `r P0P`]V \V00S`ppV- [V @Y0fS P]T Y 0   0`A@.T4p4p `0L`0   0Q0   0AW ` /W00S.W00  Z R 0Z/S0=S`0]S]Y  4 RP @T Y`v:0C40 RG 0R0B :RpC  ]R@fJP4-  DG0P 00B@(PU@ T(0SfP0E SpzTz8z zzyyyy|y`yDyyx`ܓ40S@TP [PpT*0D?TS!T@T? Z``  0[=0  + 0a'  \L:Y@1PY C (@0   ; 0!70@Z1 ` C 0Z/S@* P0    0!$P[0   D@P @PPP/ p 0 00 z  p01 0 r 0[S XHR]RA `00#\R00S 0S QR [R0:S=S .S0!@0   {0A r4 90408 0#6   010_\   0#4 ~ 06 w 0#1 p  0#7 i 04 b 0 /\ 05 U  00 N0  H 0#5 A 01    `00#\V00SppYfPEZC*,[VP``Y &R 0Z3 V,Q 0(S 忞PP Y R`  0P@0    0!$^@0    0! P @P` 0P$P@0   0q [Q@0    0! [RhO-M 00@ p(S@ DP !0DS"$}}}}}}}}\~\~}}}}}}}}}}}}}}}}}}}}}`YЍ?T `@| @0 Sz W@L@X:W 0 PP3!P @0PP*Tk `@| W"@@ 0PW PP3 @0PP 0W C@0 PP @X*`YW 0` P@| W@ 0Dp3PPYW !3P `X* @0Pv@ 0@P@Cɝ@0P@Pe @0P[ @0PWQ@-PQP M`p G@D0 p Ѝp@-M@P`P  P  P   @  @ЍpO-PRM@P``pP 00Ѝ ``0P@0 P ܐ D0S \S0 0R0:0!0 00 S" BP 0  K0S ᯐ᭐ a  !@P `P W  Bᓐᑐ` ጐነ@ᅐG-SMPp8 @᎝U`= Y * 0 0S@ 0@S@  X ``PP 0S1 \S 0 0 0SЍ0Qx tp0p0m@P  0  @徦U %00   Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/-@-@A/Q aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C SRXR#:4R005$0\, 0l\9c%Cx'x )8HR@J*RJ@@b.` 8#8R0`F*R`F 8 SS:4\00<#ࠃࠓ0^ VY !0#* 0ЍRPU:4U005P#0\@e(%x- *Z 0j6C93%x0U(  8HR@K:@b`B8#8R`F:@b . )8HR@J*RJ@@b` 8#8R0`F*R`F 8 S00<!ࠃ ࠓ0^z + 0k5+6C93(  0{ x 'x [ 8HR0@0C0>:@b d ` 8#8R`F(:0 b.Ƞ%8 8"H 8R:00 TP0 7 0N 4U 00@R 00R`FR0C@0R`FcRK@M (Q RS 10 0 /Q//Q RS 1 0 /Q//D//-0MS 3/Ѝ-M#-M#G-Q1P0MS`@A 3/P  Ѝ!0 0b100SC0 0Q* 0? 0 p!!Y 000C0T* ^ N0110H00S0C 0 S0 L0P !!00 L0P L 0S110 0#<T0 00P P40 00$0 00 8PxO-MOP@p x8qcT@`N pN pVp1p|1  09/P V .6T T `ߍx1@0 .' @0@|1x*`  < @ 0@-@MP@P @00 P P '" 0@-@ 0MS@P P P " v "p@-<0M@0`P00@P  P@ 0 T ލpH 0S<0 @0AE-@MPQ SSh&h"x0SЍS8 01!0 0Q 80 v 8 1  0P01U 8_00H[O-şDMSL000 0$ ,0 4,00 4 50$ P0R80000/0S,  HRPP`80`pp 0@  08 T00R#3 0 R` +*$ R00 S0S ,9PP R 8@ 0 @ 0 @ x3  08@R DЍ$ 0RX\P Z\LZ `#$P<0X@ 0P U@ 0<S 0P Ux 0S.`+$ R9\  q X0q<0 L2Q$< 0P< <0SUZ.8505 !0,40G`S 1J 0 @Q80T' 0` 0 @C80T(0S8 0 C  08;l(0S0 ,00 (40S) B`  0 (p80<  0$ M0AA80d0P? 8  05 10, @l<000488-! /! /--0 -@HЍ/--0 -@HЍ/--0 -2@HЍ/--0 -0@HЍ/-M 0 L00ЍE-pMP0S0C0  0S= 0C 000 L\/ 2 `VF0S0C0  0S  0C 00 00#, 4 S} &B 0Pt0 S0C0 0SZ- Ѝ? 0  `H@ 0 0f 0  NVN R R``F @0@, 0@9 @  0@  0@+ \ 0S   (- \ \0S0C0  0S|$ 0C 00 0 <  0&0jPN V 00.R#.)0YP= V V8 0S  '0CGP+ r\ \o \0S0C0  0SX# 0C 00 0 <  0&0S    ''\0S0C0  0S" 0C 00 0 <  0&0S0C0  0ST" 0C 00 0 <  0&0S0C0e < o 0mP 0  KQ0A0  0S  0C 0000#,    0ΌQ0A 0  0 SC  000#,  0όΌ 0 m0S0C0 <   0S 0C 00 0 0S 0C 00 0 -LM0 4 0  /Ѝ-M 0 0HЍG-ßM\     1"2 "0SJ72@T6@+Pj@00C R00T0S  00@ S1  0 B00@ S.P@T T0d҃1 ^v0SS 1RM}@0 B2"1!Z  l Q :Y   a h1 R1X 8/fP-J@`02D$f?"`00  03/N`P/@ PU&?U0?0@jR*k0s3Z03/ PE@0S:?C:0UU 4tj؏9 Џԏ܏؟@-plM@a p lЍ000 R0SP`P` p p T  P0: S 0S 80 0 b $0S  -M ЍT@- L@L0  @@0 8 @00$ $0x88888-0 O-1 M\ !02 \: \*0SQ1X Hp0 0L! 0J   J@B Q0b@@a>0 00 4 0PWpP pi! `0! @X 2@0 ,$0(8" d 嘫!00000d \0\ P3 Ѝ@99x  88888q8 80p@-0bCa 1P@@053/Vp@*ď̏E-0儠M0jCQp` @ @U2@@00jCQ @ @UЍď @- 00 O-@㐱Mp TT@h1!XQ XP@Pܐ 00ZT`@p-P TZ @#P`ЍP @ۉ0P`  ЍO舕щP` p` @T@\0!XQ XP@P@=00;0 T0;0C0@꺠|<$ - PL|MP`Q q0@@ҏPP(K&10@P0t40 00 _0P 0SUh` V h` <&@0S:?C:0S 6AT` 04 h0K`P 0s00h%P Ph hK=P T 5aP 0/h%h@P@T `5P @@<XP <%P 5X,%000%0S0hPY 1, K0 Y<`;P$@0S:?C:0S !0Kd4@BhKh0K`p0L$s00@T P.PP<pGJ`FHI0S0 Y 04 0MP0S Y80 S !є@0`h0KP@@P`T  lR 0R TP 40Sl0}Ph3P q0h0 t" 0P0 hKPP⸂` !AR, K0pp  2!1S 3/,K0@ <@`T T2R E@@ VV`"XP 2P 71XP "0000@K4K: 0APP!:0P P/0 p&0 \p100 c  p=+P*  Pg@@ TT@0S0  P,K10<; P 00p T  0P0l QQ1, K0< RH  0P0X|8Ƞ8 `$P 0@-\. @P_\ -\ .\ ,\ :\ /\ \ 40  <0 ! \U0A/ S 000PU 00CS0/ 0S 00 R 0S00068 -LW<9 0_0 Rc]0 R: 0R0QG0 e pTl T0E&|T0A60 d  $t8h$4uܻ P -00 X4 0@-d \@$0400\8P(0̃<@0S0(0( 0 00P0|ܺ t M\pP`@ ,P@(pE$40D0 0$ ^e  1!<, 44H Q:^0!< 4,4< p3P#0hWpc p0D^!!< 4,4,R^ T@BQT$0 n! H0S* p3P T0XK* 0@S  1 ,<.,!4 $ 4$d <,@ QP@ L ;L0 0( 1R T@@ Pp0ࣀ!Z1 !<, 44@  ଅP@ pTP P(KT(0 n! L P dQ ` RB P? 7S @3/ PxP 0E@DL7S @3/U1 0s P` p ATX e  L L0@P@ 0 1 @L P@ v0S&+ P60 \1Px6S @3/W 21C8 0C @T E P &P@D6S @3/&U@P 0S%00괅P~P  ᄊ% T}P0P0 0Vx%0S:?C:0SILP0D0`0 40 V`62C50@P7 0 Tğ3 0@0C04 0tS㴤40 L0 N8K0K40K /PP@@ PV`P 62C0 >0j~`@00+x@@0SP 80A @P 8@埄P 21CP  0K\`#0Pg 媆Pc 0S S S S  S S S 0 S000 cp0 0/S 0S0j0 0 cR  2 < 10 R^Z0@ 0/S@ 0S0g0 0 cR 82<10 RT6@  0@M,P?  <00<0400a0C0 X040a0a 00t R00X @P0SEڍ0 ,pP@ =/0T00/0^00  s 0sp R @2/ UwP@ !e0 p0X@VX^ @03/P P0 8pP X 8p@-@P``d0 P@1@#@T:0 R:pp -QLDMX T \ `0 Q00 Q0SpVU h5/T XRX60T0 +00 c@ @ ẌT00QU<  5/%a%D R 2/D0S % 0S %5 XH 31X/ T!P0L0 0/S' L廃\U\p 0"S000 c 0`L `@L- 0P%P LL 4 4@RPP 0SQPT儃8 ၃8  `0d0 X8 TnXn `` :Rm RC00  0  R:R3 R] 0R RC 如P> d L0 PP 0KX 0:PE z, Z D R D  3 DP 0 D0000$3`H 0Q j2S 3/ (K` R X0\Q"R `2/2`H 0Q XP/PP0P p@pP@z X 0P P100P0 `Q!R 2/^P 0R@ 0RP; P!R 02/1`H 0Q X P00t<奂80@{`P{ @ X╆80T Pl8@@<P 0 P0 0 00R0 T2/TH bH@Q ,1/T 0SM XuJT8 8t ĨԬ$Ĭ܏<4 -LdŸ MS2 PS0TS0RS0SQ6\x6oRp6 uRh6 xR`6 XRT60S L0S06S0S r0AS0XS0S!0AS0SS0TS08S 1S 3S~ 6S 04S} 0Sz0ESv0ASs0SSp0TSm 08Si 1S 3S 6Sd 04Sa 0S^02SZ xP ^ 0! ,0 !   1 00  `V ^ 0! <,!44<!< 4,4<00S  1Sf V0!< 4,4<s^ V B 0S 0 <,!44<!<, 44, 1Q 00V0 !< 4,4<s00S| V!< 4,40Q `V R 01   00S0  l 0R,\ `4@0PT0!< 4,4`<\0P10{,`@ePFa0aUPc P00!R00 0Y10 0$(04 00^01 0006  !0P ,,. pR 10P&@0S :S0:S 0S:S 0S:SQ`P0S@ 0SЍ@0 pPD`4@ ;p@-@PM2 0S 3/0`SPp@p U000 U n0S 3/ЍxpzP zP U@ D @000$0@z@P@Ȭ8O-DM$h`t{ p, ( Z0RPK040@C|c{(0 |tPP1 + : ㇂/@0E @h,0SDY=X64\.@|$ Xp p0S zP 1p X0S.nDЍx{@t{Pp{0l{(@00x.00t.00p_00l~0S U,U 13,3 0B1AC2  @ف$D@tP8e 8 P ˁP0X 8W000$  008 0 0  ḁPppFW4`<`< , 18@0T` P T*:@T` zh l$pt0 x| PTZ @@T`pW*8 10  `P@:0S00am8OUU33G-`Qp@% 1i0瘡P@@T ^  R0$ , 00   R> 0@ PT@UgsP$ T P#V @ S@ŔT 4 R 0 00A  0S 1@T000 x~Pl00 $0, 0$ , 00400 00< 0 `  4 4  ~ G- p$P000000S_So @Sm .Sk @S .S 0S_SP@^ @S` _S ` .R* @R 0S 0S`P 0S`0  0 R`_0C0@0S.S 20S.S - @S `00 R@RR& @0S@SP` @ Q  `P` xP ` hl ` @``@/@-@P0S S S @Ml @-PPM@p` JP 0 BS QAgrP U1   0<R0! 0L@PU@DZЍU- M  Ѝ -LNMM~KM pG pG rK 0 $ t 4  %尐 00CX,:8Q7 jQ!05  1 0a00 c1Q 5@` q } }@0D0CX*0pCd T@0P $r $R((7Q 7$ӗ@85S7 R1 60S5 8C(6`P B0e R<0(0SC 06G x6 B兀H p05S<P6D&8C(Z r b$R; ZpG 0q00@8 s  5R5 R%8C( JP R\  $ O(K r 0 b4 D5 RL5= 4S  0 R R R R $ |R``````````````````````````````````lP`$$``0000000000$x$``````````````````````````````````````````````$`````````````P0=SS  % $R04 %004 Q R 4S04 5Q0A |08 K80  0@8 K8 40 0@  C > P000S <4  A?% 4 0=S\!0  04  $ 5  L$ 0=S0 4  A/ $   % 04  0A5  |0 B00A S1   0 B00A ST0% 4 j0=Sd `30C $ 5  % ^''LR*b|G-@PMp% wxsxPZ @ T 00`P@T  R0$ , 0 00D Sd0 0 Ѝ   0S 00P00 ꠯ r q "0"" #0"S/D@P$1SUA o8@   /&0 S-L Kh@-P^XD0TTp@XD C p p ᰀP1S`\0 `0? H0;0 &Rp p0 `0 o o |o @-pQFMP@ 0 0z00 T  Wp0 pp(0?T00S 00 z 0 0FߍⰀ `0`\0PX  3 0404808 P ,0 `0p 9%%%%4n 0@S-00  m @-@QMPp 0S0  0p p ЍⰀ z !0 @ 00 b @m %p p p/1p@-M`@ PP#TE 02x 00"1  P ЍpE,!0!0!204:-PM  /yЍ Q 00l PQ-@Q@ @ 000A!0#!k PQ-@QH % 00A0 #1 01 Tk wpwpppp0Jn@SM  @0S:?C:0S`0p0W0m 0Se 0S S1 0ASC 0SH 0S00? S= 0 CR00 > [0tQS  @0S:?C:0S $`0 00 @ 00tx |M00 BR0 0000K00尞00 0S0 p00XYP@ @@x0 0 0 vLHO-RM( Ppp U 0@ᘤ& ;/PPUЍO-RM ;0墀`h&ph   0 PS,*t**) x PHXW  ;/P xpG `XWP X  0g 0 ЍOxЍ xXW ;/P00HpG00XWPXW ;/P00HpG00XWPXWpGXWP ;/PH @ @XW  ;/P  PH pG `R*00 - RL,M@P L P`1@ T:R0Sxf V0PY\2P0@lD2P0@H 0 K 0 Z4` 80 < cP00 XD L* 0 D P00P 0<K<0 8 P RV 0@0 @Q U D  &x@p `PL  ba@ x1` SpQD x@0P0S@0 . LP 0A(KUCp100S 0C1070PL 0Z Z 080 LP <KHe00 c H 0 |L0080  \Xd d @P0S 0S 0C"00 S# S S0S `0R e0SD@D`T*03/T:pt@-!@0S:?C:0SXqPH Q2 A 20 R 20 Q$ 0 BS0A Q20  P U   0@ 0SᰀPT 0P0 0R0@ Uj@P 00@@PR0 pZ 0J`8p@-@P`Ppp00p0P@- P|@ 0zX00 @0S 4  04 0T0 Ԁ0l,_ 4 D-M0 y{Ѝ0Q@- \P d0kzX00 @0S 4  04 0T0 ក08T^ 4 D0@-(0P0@ M0@` Ѝ0] p@-$@`@PMPSЍp] 0@-(0P0@ M0@q Ѝ0p] p@-$@`@PMPdЍp8] 0@-(0P0@ M0@x Ѝ0] p@-$@`@PMPkЍp\ 0@-(0P0w@ M0@ Ѝ0\ p@-$@`@iPMPЍp`\ O-M8S @P00?^$P\ 4P0  ` `0  Q -Q0`0 +Q 0 `00XF P| P@y p3#0[ 0] ZP W 00L  RDW9 0R 3 0R-Q0N\= Z R[g 0"S "00" 00Ѝp3PPZ \ W 40   < 170C P X:U %% 0S*V0S  0bS< P@1XS@ 0Z p  ppP { ^ 4 0R0Q j0S11S: Re0< XQ`JA,00C0S (@0S0P0S0X 00L0 S 0S  0RP\ 0  0   < 170C S갰$Z Z - M00 ЍO-M8S @P00?X$PV 4p0  P P0  Q -Q0P0 +Q 0 P00X@ Pv P@s `t3t#0[ 0W Zp Q 00L  R>V3 0R - 0R'Q0N\7 Z R[0Spg" 0p0Ѝp3PPO \ V 40   < 170C P X:W '' 0S*U Rp  0bS< P@1XS5 p0Z `  o`P  ^ 0 0R,Q p0< XQPJA,00C0S1(@0S/,0P0S0p N "0p0X 00L0 S 0S  0RP\ 0  *0   < 170C S갰$U S - M00 ЍO-DMh SPbpU00?o$Um4@0   0  Q -Q   +Q00`0VY Ux UEu 5! 5\a0@50$0= Y @2 00@ \RZG 0R A 0R; Q0NPD Y 0( ,0 040X P4 RS 0%S "0@Q@Q0$ 0@P0DЍu3UU PP Z 40   < 170C\V8$ 0( ,0Y   P ^nP V  0R Q Po0,SAA00P @T ( r0( ,0(@0 0( ,00O80<@@`4@(@<08@,0 0 @0 @(0,@@Tn ^c 00D \Z 0S  0S P0N`Z 40  M < 170C\G,@T  (@T `, 0R$@ TA*@`4@( 0R 0S@PB @0dS< P@1XS 0 @P020< XQ`PJA25( Rp 0P0S @P,00C0S(p0S` ( ,0k0@ (0,@ 0( ,0V 00L0 S 0S  0R P\ 0  P0   < 170C Sذ$,Q Q - M00A ЍO-LMpSPapU00?m$Uk4@0   0  Q -Q +Q`0VY U} UEz 6! 6\a 0$@50,06 Y @7 00N \PZE 0R P 0RJ Q0D@^j Y 00 40 @0<0X ^@<P@T 0p04%0@ 004@000LЍu3UU PP 40  1 < 170C\ V. Z 40   04 Y   P lP V  0R Q Pj 00 40 00 40@D`<0@D0 40 00 400000 04@^r Td 00N \Z 0S  0S P0D@`Z 40  Q < 170C\K4$^  00 S `4$P, RD*0`<00 QQ @0dS< P@1XS 0 0 40@0@60< XQ`PJA69 00 40' @ 0P0S04,00C0S(p0S` 04`@04 @04 0@ 004@"00V 00L0 S 0S  0R P\ 0 N P0   < 170C Sذ$J E - M008 Ѝ@- @ 0 @bD 0@-@P@z00@XD O-M04`@p P 00A SV 0S @!00PE00CU@ P R+00 R0 0S 0S0 R@(0 R QA 1R00FЍ1  0R0 \ 0@S 0Q 0 0 0 100  0P 0 0S0P00! ( 00 R00 0T  P0R0 \ 0ES 0Q 0 00  PU 0 0S0 0hʚ;E-P MUp `$@e5\! !0@P0I060C@5\F S00QX@@` 86, T  060C! 0S0@*00S0  (1UQ ЍE  0 0P60 UZPP@@Ѝ\0LQ`0 0S0 R@ 60C0 @0086,P 0 `LP8A O-qM40<8R0X0\0$j4T<4P@ 0*-T! +TP@D \ 0 0 S 0S0 R0/S00D Sl80!iRd nRx 8PS < 8@P qߍ9S0T 4 8 0H0Xp3Z0 0Tpp@0T 0D0 S1H`Q`V 00S \x 0 So Yp0V0U0S`0 S{HPs Z \PU:[PP\ 0 S l0Si0 RT   a0LS\00R0u0S P00B S`H0S !H@0P0eR0SR [{0V0SxA0QI0S [00Y0S ^A~80SYD\ @Qf0S0 RH RUT0 00B S1a0C0S{1a0C0S@0D| H^@@p\^ H 0P0eR0S -Qb +Q0`0`00A STx `^0k 11C !0000CP00A S`\n [@PD40 81xSP@H\fV&T 4 4 0#60#0SL0PqT00I?Y00SKd T00@ S00 ` HQeV 00S X \0= 8 R U<- <80D^F@PU' @T`@ T@V 0^ 0S0 RH1^T !b0 eHQ !RQ kQa6  Rt8Q~.t RSnύTEXt E/o?A ^QV vQ||E`d5 0@QPPd0QPEdQ^`p1  0&@CT d  0 |!d P0X V  Ue W#! ! P!* 0 00C SR P R!|ElQE 10 R:4R0023 bb QPGP 5R50B@rs \Ekύ1kD `d0 E2$&Qk 0gS1SE1S ! 0t P Q RkND @P`PM?k0ZLf B06lP8P @$0 +l8P@@D R R@4 4`0  0   0P 0@ Q40P8 1 NWPC2@ 1` @PIYU0  T@00A S408 @1@WC\"10 L!IYL Uk/ kύ 0k1 UkD 0V@P*- 0l0#PE0u  100kύEP00tP `[|001 @c`|pEhh L 0 B1L !kT`P,  L0^ @$ T  L BB 0L0CP LNpL5г($VUUU$ |# P Lo?L @nύ$TXE/ A $ 0D!R8:4R0023 @bTL 0||EE0!P !10PQLPP: Po L!0A1(0b$(|00EDaD~PQ1 0 żQL P¼QRU10CE 0 R0@ p L0P1,0 05\D!LլPҸp0ՓUpO &  Z$ x͍ 0'xᬰ +8HR@I*RI@@b  PA 8#88R0PE*RPE00b x@P('( "Ȝ!\N2 h(@^0 f0\RpGP*0 0E|5, =@0P EE| L0pG$@0PPP,0E/L  B0R0!P\cWj W*W 0073 b 0aa5S5 0a73,p P1L0 ?U00S ,EύLA 0?R00Sh p0OkcND 0@@P0k B jP0(Sh U@8^}8^DP R 00yR 00P R ʬ1 P 1q1q 0C1qP050sp0,0PtYP@A/-000bS Sek 0cEaQ0eS 0k1 0eSkkQ4W00Y a05QP1q48U1|PS`IqlP05S@iW &  x'x +8HR@I*RI@@b   8#8(P H*PH ` H%$(8  "Ȝ"  Pf00\00S 0\Q@D*0 SpP\+T: T]*T 0043 b 0aa5SF5 0a43l1h0W0SPP[Pl0`NkD P@PPPʬ1 P1Ax: e0@pA NAjP5ql  l0kkl0 c1421UEe@ a05QP1ALڵ4T00|pQ*'a@HS`@`@*S`F@@cNP0R0C*R0CPPb\hV" VC*V 0063 b 0aa5S a05QP1apPP ʬ1 P1aa NaP5paW  0kk 1 g621h@gU@kND 0@@P4V00k?0k!kEsh!R+P,,70`A08 R <80@P kkp1 l721N,Dz "0Q0\@P0LS @e"P2p5Wʬ1 p 1!PpU 0Eύ1!01P0 Q# 0E1 REύk10G0@D k@@P\u `0-/ S"00 D\ 000C S8 R 80@PA,\00C0S( X 0Sek 0CEqQ e1R-0 0kύ1 0eS40`8 00B S1a0C0S_R )R) B40m1pS@ _y,/@00<0$'!:&6c @Pf-10 2$!L0|E!gX R 0S 0S X0 R0F`z Vj pl Xp`0T V 0S0SX0 R0Gp@P 5 bRp np^kk 0QP17n!0A 00wYpG! 0P U0@ r01 r01,Q Q$ (01W R# R 40 4 $^ !R  R^ RX RS   0 @r R40 4 40 4 4 R  R 4=R44   4 lP 04 h\00P0S,T  dP 04 f5\00S,D  fx 0jpP$4 4  4 $Rt5t0P`d5 % % 2 0R-0304 5#*8%4 0C8% 4 i 0R-0304 5*88 ` 0R-0304 5*85085 0  88  0R-0304 5*850L85 j0  88 ?W  8% 8% pX  88  ,@5,<%@5$R!$0@1$ l5 $ <0( X$*X:<` P|P xP |K P00 c`$0<K\Zp@2 $pRJ$RW0  P"8\8  WUs( 3 2Cp$8 R\@ X@  R00 c$\0K8K&Zp@ pPbJ %RWh0  P8 \8  WpZh bCe 0R+0304 5*8$ B8 $  0R+0304 5*88  0R+0304 5*8% 8% u 0R+0304 5*8A8  e(#0j 0x%  Q; $ 1 \PUmp W8 ^00 c8K \0KTV/pPp@$0 K!PP@ t0,RT.T> ``0^ G  BBZPP 0';^E 0@NQ@h 0R4@D 5*t@ 02N(K   00`P lM0 @秸 RX @00  %<0 0,1`P146@ @(P`0@@A\ 0$ A\0$ R*$000 $R0a:,|-!2 R>;1 0 S8 40ETP=400P 40 z 4@G_ 06, l=$!000c!Q@ &(0S @ @P ,0HP`0j0eZ PP[ P` 00SU@(Q 0@[_ \ 0R00304 5*0[. \ 0RD*q PM 0@ D@00S  U R[ \ 0RI*800 DZ[ \ 0R** qP"ZB 00`@0 S 0[0" S@1@0T+ $ \$  0R* qP @j` R 00   x*x  PP @  HP:P0H H?c U[   P@` @[   P@[ \ 0R-0304 5*@- pP@P \  0RH* qPPEu@[ \ 0R+0304 5:+\ p[   P@~[ \ 0R 0304 5: A p'pb@g488QAA 40 40?c0400T00S    B0 0S@ z 0 `Z 08S0R Z 0 S0B  Q "R @ZJ` 9V0J P 000$1@Tw:P`U9V $ 0S 1eS 000$0! !c 0R00304 5:0'pP @  & 0R-0304 5-:-'p.  Y 0R+0304 5:+&p 0R 0304 5 : &p  5岵B =  b50 $0, }800 A R0#S 8 9RI 8 [} \ 0R+0304 5\*@)[V \ 0R-0304 5:-T pP@[k \ 0R 0304 5: @ p0$ 1 0 p40 $0, d* p8DC@0S, 81eS0080է0Q 4  BR4 410`1 80408 Ֆ 0R-0304 5:-P&p 0R4 5:C&p 0R+0304 5:+5&p 0R 0304 5t: '&p20 00< 0   Q@  0R4 5*@0T@ @bT0[ \ 0R*q P00S+-[ \ 0R*q P[@ P \ 0R* qP0 @Z 0  0QU[  P @ 0R*8 Rv=P< @_D< 0@TX  0R4 5:%p@m 0 606 pi4010408X PHP | `L$p ԺD  x  0R4 5o:\%pf+ p[\ 0 >P'D  D 00 00<0;%p/@ p  p8(%pP @ p[N 0 P8 p p$ 0R4 5 :$p p0 y Q `$0 @`V , 0R4 5:$p@ \| p0 Q--M0 0CЍ Ѝ/--(0 M 5 ЍЍ/ -- M 0  ЍЍ/--M0 0_Ѝ Ѝ/--M0 0Ѝ Ѝ/@-H 0pCWp倀H0pH 0S E0 p-0 00B00L S1   0B00L SE-@   @ P$ P! M  P 0 B Rp` 0 0C)S2D 4 $   t 00 0 PP0S 0`  000 0`0 *S 00C S`000 0.R 0 0 0    0L0CP.S              T                          T      T 000 0 0 0 0@0 0 00 0 00 0 00 0 00 0  4 PR0A A,07R񟗴 x  x    x x x x x x x x x x x  x x x x  x x x x x x x x  x D     x  x x x x    x x  x  x x  P000 0.RPPP0 *S 00C S00EP@P`PP0`00C S} 0SP `P$P!0$S0@$0 PR %5P 00 0 lRtPP 00 0n0hS 0 0P00 0 0Pc 00 0  \PEPY 0<(0 <(0;(0 003 0(0$0s Q0E00 Ѝ0,0$0s,0S`$Q0E00 P%,A;(00(00(00(00(0 010(0$P} P0$Sy0@ 0 PR %5PpPP000C S0S P`PPP P0$S0@0 PR %5PQ40 1S ( 3/P,9; -p-PPL0MP  l0@S:100 ` c1P 0    ! P nРKp- 0 A-0P dIG  @  H 0@CT@Y l0S(Xp "@0S:?C:0S`P$^P\0SM1 U 1 U 1 U 00,$0S 0Hp喨0Jn@S  0S:?C:0S&H0`Hp0000' 0H0@H 0Ss0 p`f0 p׽0` H 0@CT@ 2H0@H 0SH0 p: A-0MrSPb wS] aS !0 00ЍaK p0 mSE S +S8 RAp7 0$& T  D Z-2@P+ 0WH008 /0 $10VPP3 0A= 000S  00 pjRp`@`@x il0+p 0Lc+{ \z \@-pPM= 0IHP大0Jn@S  0S:?C:0S*H0`HP000000PPP H 0@CT@ ЍH0@H 0Ss0 pЍ@{0P H 0@CT@ |* Ѝ E-Mp70`I) l0S0Cl0> 0 PP P0 H 0@CT@ ЍH0@H 0S_0 pHPU0J@S  0S:?C:0S H0HP000s᳻0P H 0@CT@ H0@H 0S$0 pO-PMp P 0I! l0S0Cl0 0 `0 H 0@CT@+ V PЍs`H`0J@ S  0S:?C:0SH0H`000l0S0Cl0 H0@H 0Sȥ0 p90P H 0@CT@ ᔡH0@H 0Sڪ0 pO-M,[00l0`S0Cl0Rp % V@1@! k80P \;0`d0V0 P0  eRp`F P V iЍ( @R`e@` 5;0i @[ i( R   i@-M@@Ѝ@- QMPp 0Qp 0 0S* pR@`@`T ژ0 P@D` ЍT 0`'7G- 6P0IHp0Jn@S  0S:?C:0SBH0`Hp000 `Al0S0Cl0 l0s `0 H 0@CT@ H0@H 0SϤ0 p0   P` 0R 0304 5`2: p `(0` H 0@CT@ რH0@H 0Sڙ0 pG-PI`Hp冤0J@S  0S:?C:0SQH0Hp000V3 V+ V ` H 0@CT@  Z' 0,P``H0@H 0SF0 p< 0 Z`0S04P ` ᜹0` H 0@CT@ H0@H 0S 0 pA-Mp@P` 0Ppp\0   0@Rp4 5*Ѝ #@- QDMPp 0Qp 0@M<0CS pR@`@`T ژ0 P@D` DЍT 0`HE-鐡MP0IHp坣0Jn@S  0S:?C:0S-H0`Hp0000 R0204 5`1*0 H 0@CT@ ЍH0@H 0Sj0 p`׸0` H 0@CT@ 2H0@H 0SH0 p\00 \bA/0P\/-0\<0(\ (\0 \ \00-0\<0(\ (\0 \ \00@-0@p\ 00@-\@ 0R0 00\ 0R \00\   0;0$00\0 p\@-\@ 0RP0B0 0p000@-\ @0Q 0A0\ 0p0000p0001-Q *0N S Q*0< S0lC1C0@-P0M @  \0  aB! 0000PЍ0\0  aB! t0 R/0 \0\0   a a0BB`/0@-@MTP Ѝ0 R 0 \!000 0  \!000 @-0@  \0 &\  \0(\ $00S000$0S/0@-l0MS@P0 Ѝ0E-RM / p `\P00`C!RR !RR@ @@0T0\ 00p`dV p p`F@:1p fЍE-M`\Pp( 0g nCA`B!T0PdT 00$0\ 00P 0cC 00a0PЍ :\A e:\0  adB!:\d+pP@ U\0 :\ P l%\ p1\ 0(0\\0( e:\0 aB!:@-l0@S]P l0S" 0  Xp \ P:0  00S qP0 \ P*0$0S A-`pP\ 00lC!RR !RR@  @@0T0\ 00pPdU pe @$:\!0p00@-l0@SP l0S# 0  p \ R:0  00S P0\ R*  0S E-\ MQP 0 * 0B0Ѝ0 2 00bCaᆁ*pP@; @f\0A@ 9\0~$\ p\0@\ \0$0\0S ^0C0 0S P\00X\ 0S *P \0 \ 0<(0\ (0$0\@-@\M`\pP <0 `\0Up<0<000<0<0Ѝ lK\0@-@ MP "0@p )0 Ѝ00@-\MP@U Ѝ0004p\ 0Ѝ0@0@-\M @R <0P 0 R 00 R$0S \0 #0$0Ѝ0@b\0PP@-@| p\ 00@-0M@G\ Q54: XPQ: p, \ 0S) ,04 \0  \00 0,  0\0P5:x0T0瞟 UA Ѝ0 P }#0<0e\ 0 0 熟 00@Y X O-`\M $MpS*HPL Z 0  0Q`6\pP 0R3_Pp_\0S U^ Ur ZU Pq ^  00nOSQQ: 0\ 0004, X@ 0\ 000 0;J\ 0 , P*0\\0 P@0U00 0@$ЍڍX@P\0 aB!OpWP r pP A0HP+ 8P 0@p@Pw 0 P@TP\0     00p0\ 00\  \0  \00(0: SH0pPNrR P0bO a@@TP?Uʒ 00 0@Qpೄ 0Y8 0  aK@zP@ Pp p 81*0 b DKK ᄵ  p 10 b p p P0 0 b PRnK`F`F P p p T +p p@`00 d p@00 b ( 7 <h7 \(7 |6 |6 X6 @ f@-QP M@PQ00 ` A  0npP 000P Ѝ 000外0 RP5 0@-80 MsP P Ѝ0 0 @ @ P0T@ 080 0 $pq0|0 R4 @- M$pQP`  PP`0bOPU` Ѝ 0S' S 0 0bOP`V%00 0@QP` 0n ?V 00 00PT000 0bOP`V0 . 0P`0U x3 @-M@@QPTЍ80@-0 M\P   b?8  0bOP 0 00 0bO P0T@  Ѝ0Q 0 00C-|M0PHP 0: S l0S1Հ!|!՘0՘ \0 |Ѝ@0 QP*P r# S# 8 0 妣p` @ 8pp峦0@@S ᭣@0P0T@sRT 0! Pp @ l 0Q 0 `@08 P0T@, ,0՘ Ř0ըT0sPTP괾Xp@-@P` 0 p@-@{0@-p8 p 0R0 b  0 @-@ M`Q00 08p p Ѝ␀070 b / E-tM0PHP0: S  `,l 0R0 00 00020"Ř0("\0  tЍ8`0 WV*; 00l@ 0@ n 0@@0  R:@ `80 0bO lP`/`VpRP`Tp 30 0lT `R P0S* 80``ť 0 0bOP! 0 00 T  B  0Υp 80 Q  QQPT|S괾E-`0M@fTPp:TjЍT@! n)@@0  7P0`@fT050305 W)`0pd@fW  0j@- @R58P P0%50##0%0A-0PS@c X@ p`@aT4*T=0 7Q 00aV<:Q   0aQO a08P.Pqp``% 0O0@P0T@V @aT: )000  (0p0`d0 pfr00ff0 000$P 0<0@-0 MJPp` 0@P0T@0 <4@SPl0S  00 Ѝ0 S  c00?@p PTC  00S0 0qE-pR`MP4 0 < S1 0S@ `R@ R@1@!TAT 00 R@d0S 0 p2 0cQPT-TdЍ 0 `WU)*0QA S U#*0q S0e h @`d (@dTd MU@`d@-@R@PA-R`P@@`T<0 8唚PP0d 00PR0O0@P0T@PRd8p p 0Ȓ0 b % 80 ;@-<08@?8p p က0嬒0 b p% O-p MPᨠ嬰 0 [R<:0 90S Z_ Z9 [q PP`u 0S  00nOP Q~ VzUx0`0 V0 K00 0@P `&P P`0HP5  0@pP` 0PPT` 0 00000Ѝ PP`0bOXu Y" 0P`0P `(0: SH0~v[ 0@pP`} PPT`vp P0bO a `PU`?Vb_ 00 0@Q 0R8 0  a @10 Sp; X0Dl0`S\0 R  0\ \0\ \ \0 0c00 00000s@0P0T@d0V `08 Ѝl0S\0  aB!p  ap $ -LM`8Pp (K0rS wS aS #咏 00s0@eS bS S pPD3P 4"P @ ,' d00 cP`$ Q 2p<@4_Q -Q .Q ,Q :Q /Qw Q 0  10QW0A/ S 00 R ,2 < 1S0<K.PPZ80Sn0pWf\x 00\ 00\0P,P\08P4P\@<X$80\0< pPtplp` \0P,0x00  40Ppp0\0H!,0 0\ 00lp РNmS<00<0 xS@\c 0 eSY] pMpIpW cS<00<0J@0Î0  Р+Sz@wHH.D0帖@4< 00峖 Рጊ H $oE- MP0P54:0So 20S p0IL 0? Sl 0 # 0 0 00000 c08P)0P0q0 0O0@P0T@0ЍH 0@CT@H0@H 0SL0 pr000 000H`60J@S  0S:?C:0S H0H`000$P 0<0 0 0 0  00}0P H 0@CT@ ؉H0@H 0S0 p 0 0Rc/0 PR/-0$, < ,$ -0, $ <, $@-0@Q (0 00 Q ;00 p/@-0@p00-M0 Ѝ@-M@$Ѝ-H0^MX4<00 0 00000040$0(0,0000Ѝ輿p@-@P`Tl@\`\0\ \0\ \0 \ \0\ \0$\ (\0 0`0p- M 0 Ѝ//@- 0@RR0P0B0 0p000@- 0@R0B00R000p000-Q *0^N S Q*0| S0lC0@-P0M @  00  0b0b000000PЍ0000 R/P0P  R/00/0`/Q/0 00  bb0`/0@-@MTP Ѝ0 R 0  000 0  000 //////0//4//0M0Ѝ/᰿t@-P\M@p`0 0 U00p `00Ѝ  l[0p@-0@P`0p@ VU 000 00 000000p000GH 0@-0@S0 l0Sژ04pGH 0@@-Dp0 CR 倀 0S 0 pt@-0P 0 H 0pCWp p0 CR 倀 0S 0 pH0pH 0Sы0 ptp@-hPċ0Jn@S  @0S:?C:0S`000p&t@-0@  $0(0$0,000S000$0S/A-RpP`0P*0`V@1@!TT  0 R000P`dV 0 p P`F c PfE-M@y , $0aP`0nU`*PeUp00\(0a 00a0\Ѝp ! $p f^$  af! $dJP@ V dp $P  0 dp,0$,dp f  a E-@ MTP`0  0D0`DЍ0 - 0pbP4 @g @  00 @(@0TS@D@ $0SP 0@(0$,0 @@0D0`D$0S @@WP@ O-P2M S R x0 0020,姊0J@S  @0S:?C:0Sp!0Ա0P0`G P 0V014PP`U: P0IHp0S  0S:?C:0SGH0Hp0000? S 0 H 0C\H0H0S 0 p0 0 CR  R x03/ЍP 3/ 0S0 p ᝟᚟ȅ tO-2M S R` 0 020Vw"娲PO 0P0"\0  R0 p  V 0 H 0@CT@C 0Z024PPU' VP 0I l0S 0RHpɉ0J@S  0S:?C:0SVH0Hp000V PA0 CR 6  R (13/ЍH0@H 0Sژ0 pP厉0J~@S  @0S:?C:0Sp000n\ 3/g 0Sm0 pޞpڞȅ t@-M;1`PQ @0l04@TJ L10S l0S 0H CR00  ZЍ  13/ 0S0 p`  3/҇0J@S400  0 004 0 000 00H0H0S 0 p!rȅ t0@- MR@ 0P 0 R 00 R$P p 0$0Ѝ0@* bフP P0@-@ MP "0@Hp *0 Ѝ0@-l0@S0Cl00 %0S:0  00S$0S 0f0S*0s P np@-l0@S0Cl00 "P:0  00S$0S g02P*s P <pA-Pp` Q*0aV@1@!TT  00 R00p`dV pf 0p00-l0MS0Cl00 Ѝ-\ ; S ;0 P5# 0Sb b0/@-@P 0 @ 00! /O-P  MeQ@`pK 0 00  Ѝd P U 0  bE 00 R) 0 0ee ee 0  0 0 b ?Sڰ 0J$ 00S a0 0ee ee 0 0   a00RȿܿE- M,`PVp10 ! ;S@@``TT# (0S: S 0OpXAZ7000  00 0b0b Ѝ@(0S S 0OpXZ 0 00 0 0bOp0 0bOp 0!P  0P O-qppM@P WPPЍ;  S 0 `h b0R *WP0P ;0 0 P0d V P X  > f 6  0 0 h0h hh 0  0 @-RMP@p 0Q`1`#0 W0@ @@`pp@`@0Ѝ`@-0/@000/0  0 0C R0 0,0P(0H 0 000000/<@-p0 Rd0d @`0`P`XpX0X P@`0@4S,0, 4TLP(DXP@-@@0  0b\ 0aS  ^ L0 Q0N B:15#0 0a 015#0A-0p0@ 0D`0`nx@Uڄ00@T eT00S 3/P T D4 `00` D4 $P @00C/0 A//@-M@pP@`"000#J 1,UA*PЍ舏 @PP P P @PP  P P  P P  P P:00S0a0@15#  R R 0SR Sb \00W0D4 0R*\ 0   15#  R R 0SR Sb \0^` (0`, P:000S A-0 R 00CS00 @0P`嬀0 Ã@P`@0S@DTx 0Sز0 p詃0 p4XTLPl(D0@-0S@MP  Ѝ0 0 0 R*000l R:@0 00 Q ( m:LXcO-\2 M Ry 0, 0000 0 @T> 00pP0 0`cp @ T4 1 @00S0000@ 0 000 p 0 S- l1 d W 0#0%0%0@ @p0 [ @0 S( 000T0 S :P 0S 00 0U0 S :P 0S 00  Ѝ ЍOT0 00U0 00<8G-00S7 ` p R 0 0R`p P @P@00C Q 0 0Q@P PL0D( d $`  @"00 A-0000P> 0Q,A1 p``fPᣍ0@00  0@bpP 00S 3/0f,  b0 D$00  0@@D4,  Q , ; 00 8$l P00/X0 P0H H0H D0D @0@ <0/4 zd8` (4 x , 0A-Xs0SLC(8P0   P/(3(#(c(PP@$V 00#2"0`SP R @0MS  RU Q20S 3/000A2 R 0AS0LS0LS0OS0CS0_S 0S =S 0=R  R00=S 00A Sꜰ L X د L L L L L V P ⬠\0VD P ⛠K0  P ⌠<0vV vP {+0e gPP0]x _P d0N4 D D ܏8 @-1M PRpQ!@0S:?C:0S`RX0S   0 T l ر @ 0S6Ѝ1@p0@p 0@p0W 0@@p0 0@p0 0@p0PW@Wl0@ Q글0 p`(4@8 <@-0(M PR @0S:?C:0Sp X0S(ЍⰀ~p0 p4@-0P R @0S:?C:0Sp dXP0SᰀMp˕N0 p4A-cp@@7 3R00S|#@0S:?C:0S0H 00443  (0 R048<0P@004(00##&R80$R[0 #& Rn0'Rw0#9S~0|0S)    P00 0  @T4 P  0S?T0 0 004 00410 !3&S84S[ !6 Sn7Sw!Q~|Q0S  \U 00 S%% P$,, 4D4$ 40 $ $40(0,$H$44 08$ <4 0@$$ 0S DP 0 R0SE 0So0 \p\ 0S P0L D0D Д.dAELD< 8`(,0-` 0 a B 0  0 B0l  0 ?0  80@-p@00C   0`PUM Ѝ d 09p 0d00 $0 eP $ @-` V Mi3:VBtqP! @ X1@͌pP@ 46S@0@ P @@% Ѝߌ@ 0@媌p 3@?6C#ZZ@UdɌƌdÌPf㺌 80@兌p 46SP 㨌\"@E-`PM @TU p @0S@3@T @TUP\. 0S 3 R@ $ 0S:?C:0SrP1d~0PЍa 0SY~ 0pꘁAFI`PU PP- pD$H$0 E 0 00b000S㰀{0 pﰀN O-!q$MAH= P Z1 Ca0@T 010CRP0 0@QF$Ѝ Z*0`0C 媑\+ \  < X 0 00x< @Q &*3&S84S[ *6 Sn7Sw*9S~|00` p00PP"! 00p;0W  PPr PVo  @RD4R| ZVA Z` @  Q00C251:!&P81P[1! Pn1 Pw1! P|~?>10 C\PP  0Q:0Q*0Q:Q00P0 P40S0Qj^ 0 400: X00  ``9@Q=  Z:10C R 0Z0  10 0 C0q03Q0S C> \P 40 C @T60  000P  0Y*0=몑- 0  X 0@008Q -8  9#0``(z 0@0 0pSPj ^ 8( U0  X 0007@Q  7'0 Z `0 4U000p'0X  00P@ pZ@ pZ 0S 0R@ 0PjS  6 U0  U `0 :0T P :P 0S 00 P6 jX00  0  80 Z B G: 0RC 0 0 PZ6:0Pp0%X| 0%JiJQ`>P:D$000fD4 00e  f0 0D$H40RH$0 P(5 jX00 0@0 4Q Gp4P 4y0 @ P @ D40D40  0 I B\0  00I 0 0 T0 00 0 0 0 0i0[ 3@Py 30S 3/ `ppP,0S0,@83 D$T00S 0 0D$0l0Y00#` QaVE  P0a0D400c00  00 c`@Pp@# 20S 3/W; 08"0a000D$0 SD$- 0I  S 0 " E`pP@` 1p@0 R  0 0[ `3 `1Z*@  "0@埆p $P000 p@h@ "0@剆p 00 0 R 0 $ Q@ $0Td0 S d:Pa 0S 00 YW T0 00K<@'8t HPD$E-Q@MhT@ 0D T 00T@!q!Mx 00Ѝ Q nPP lQ`E' 0 d0C0pCfP0pf0 ` 0 00 0X+ 00000  000l`  0Rt0 jX00   0000TЍE"00000  0@-0M@Py0 Ѝ0@r O-!r Mp QG P\D4`V*! أ@ 0 B00 PdX d 0ӈp 00 $0 fQ $p Ѝ@PS RI00S 0 Qt BP p PL0U0P0  F" Q|0Q0  00 Q 00 Q 0000   p0TH P :P 0Sw 00 0c^1 [00  0p00!2w 0p01 [O 00 00 0 00vpx0V@! :pq 0S 1 nP B0@P  F  UpW 0 VpM0Qb:0 [` 000:` 00T0 00 P 8G-0S`3@pP*U 5/PH  G 3v0PU 0 Q 3 R PU. 0 0SX0 H0 2 R \00P0S @"1 SSS  S 2 R  3 0 qU @ 0S:?C:0SUs 0SDX @0S:?C:0SH@P P0S4U M 0Sv0 pQW iPS v 00v0 pnu0 piu0 p](@ܲA-$20`S 3/P2u0@T 0 Q 3 R &@TP PP 0Sڱu0 pdT" 0S?@ 0S:?C:0S. P0Sڋu0 p@P @0ST  P0Smu0 pފau0 pXu0 p(A-1 0`S 3/PPA_1:u0@V`T9 0 Q 3 R0TP   P0SCU8qT% @ 0S:?C:0S9  P0Su0 p]@@PU@P   P0St0 pt0 pK0@p@-0P`@! A00\0ST  4/P 00p ]000@-(0 M @PЍ0@L0O-2M@ TP` 4/PЍpqp3PpWyPH @@ 0kTt0r!qf Qpp$$:: @0S:?C:0Sf1^t0  0SPZ P PP0KWf`P  K PЍOYWP  K  0S:?C:0S+| 0Sژ0 p P t P 00|Py\0 TkPr0 pro,Ы80@-000 PM@Ѝ0@D,(@-xPPd!@0S:?C:0Sp>,_(1  0@ @000@ 0S0 00000P @, $D44 $04 $0 $40(4H$0D,$ 044 8$ 0<4$ h0@$ D$0Sᰀps0 pHAELD 8`0 @- @g@(p@-P  @0S:?C:0SpPx@ 0S@sL0Fs0  㰀pṈ450245 0>45\ 024500@@ @A @0S 0  @ h |    $A 0 @ B0000 0000 R A0/A0@ A@A@  R A0/ A0@ A @ A0@ A@ 0p@-Q0 `eS   h A@@ B456 0>56@04560>56 R@0645A 0pA @@  A@@ A@ @@- 0 S0 S 4H0l0$d 00# R@ 0P @ S 0P @ S 0P @ S 0P S~p@-P 0SpSp0SpSp4h0 &00#@  "Q@T 0^NSpSp0^NSpSp0^NSpSp0^NSpSp~p@-PQ@` `0` PS@`pA-`p@PU'P T @T@0R0RS00TPEU PPPP000p@-PQ@`p0`S PCp`@A-Pp`@TP 0 P  P0Q 0QS 00 P000@D0P P0// 0P P c/c/0@-MP AP  Ѝ0@:Ѝ00S  0S  0S  0 S 0 S 0S 0 S/ /R@-"AR 0P0P0S 10P0P0S) Rn0P0P0S0P0P0S0P0P0S  0P0P0S@T n!!R00 BR 0R/R/R/!@-pTM@6 PTЍ40 0(0Dp$0 , p 0 ( f0`PU! P0@#D0 @hH000 0D0  0 4/PP 50R4 P 0VP ^Pu4 DP/0s3/R0 0 A-P@Mp 1<QW0<0  00P`!00$ PLq af0@`VB 4p0@P@# 80 00 0 04 5/PP0 PP P!0S 0S 40g SS S S |0-f0T  @Ѝ$0P PPe L0&nH<\ 80!n80T4` `Htts`T4 D -LLMAX @pe0X0R00 c 0Wp1H @ X < D 0 Pp 0 X00L0 P@TJ XP0U`)ቝ (0KPK0  P 06/PP + RR RR R'P0gР KRR R 0e0T  X0K,0 ],0( K   , K0PK6/ P0PP0 <<g 80m40U0@ V@rTrq4 Dp@-0@`@{eP SM0PЍppO-ŸPSSM 0B(1$4Q Q@p_e0@P `WPD @A0@1q= @00 0 0E 5/PP @g 0QSWd (10S0R@DRR RR RASߍR00S Q <1e0T @ @E(!DAN? @(1@pQq宜0 0 0  05/P0g @ PP0QS ttd p0ll` \0l\L H0lL0THw s4 0lDpo`4 DO-QMh`x\RppQߍ@0 !(41 1$!@$2@0d @Pr PV@F 101aBO? 00 0 0E 4/1PP0fCq W[ 10 R(10S0DpG0\0\ \\ \ ,, (1fl\00S \00S 0Rd0T p 0Ep81`NOa0 0 0 0 4/!P0fCq PP0SpGXH{ D0-lH0TD 0x 0 l  0R  0R^10PU`^  0R@   0R@T1@F \ʎ0R&1l L0SX LX `0hS `@p ` p 1!0RL 1vX0h 0rX0  10D0 < E<0D <0D  0 x  < Q !PP pB0P@U`T>  0R 0RT10P@U`T  0R  0R^1F \ʄ0R1h PL0p03PQ \K @S@PS$p0!t100P00P AP L0P0CPSL0 LP00S @aHQH(K| Q00t l0 x Q0p h0 4<0x0 x Q:Q00R0Sx0 p0 #40|0 | Q:Q00R0S|0 t0 x Ap h ` | At l d q<41@0l0eQ 0l0eQtP S@@ R P 0 #"0 P8 pPP`8P` ZJt  t 1!0RP 1(w`U* 0 0 0@0 #"0 PU 0@pPt0 p^000 90 YIp g p 10^1*0x0 \p* 0  0 0  @b0 #"0 P\T 0@ p0 P0p03P^9 80 80QVS Mp0!t1`0@0P00P AP P NR^ʠ0R00SR @n\"*p U *ptP NP)00S0 P,@t s  R p w Ri tP P4p @bvP#P1! 0 `  0 ` H /``h \0h0U0V@c@c@4k 00h0 j 0h i 0h,`x@-@T000 1/@Sp@-MP` 0 P寞@P Q@Ѝp0@- @M`PP D P 0S 0s3Ѝ0 -LM!@0S:?C:0S]PU<>pPF 1Z\@ 0/QP0Q0d000 c1\a (1< 10\U#00 P  }P0p0 0 S(KP 嘛00/0U0R0 H0ZD:u_0 p883 D0@-|0@0_ MPP 0S0000S000Ѝ00U YhY4 DO-UMx`@$A01<(,A0 SP pX`p 0U10 1H @GRS HATV0TSS Q 10eC Po0P 0 0  06/PP QHA 0hPP@CA 10 RTv 010S @D0^0P0 P P00S P00S !_ T0@0UߍPP P ll h1gQ 0hPP@CA  G@RHA0!@=@S01@ @塖0 0 0 0 6/!P0hPCA PP0S@D0P0 P th d0f0@T0VP0J 0F<$ 0f,d 0f4W`4 D 9 {@-M@ PTЍNp p p/1qE-@P 0S<3Q0pS- :SF 0 0c0@00$#Bb20ap#10"A 0!0/bL#b@`43C" c0Spb$#Bb20a:C=C;Pp4"Ϡ2l10!0Tw z}] 0!001Q  21Cc1``D&"!B Ϡl B2  100/0cN!bS  \@! A!P1 BA`10aR0BSBQ㲀Z<0 hR10a0C 02Q R43CAc  a" ` 2 0lpX| Ϡ42l10!0T3l20!0T 03l20!0T;~ QF"*gfff$I@-PpvM `@ v TЍ08SSP< 2(0 $ PS<0@-h0h4 @X X0\lMnPk, 0UP0PЍ0< 09E-MpY똠P@T0S @ U e0`PЍ b@P` 0`(X@@X - vLM@@ 60 0!00 c ` P (KPP PR +R-R 00B S-R00-R+R00S00P0.K0K2K( 0P P- P0003K03K#[:R3C"[R42C"$ c 00 00B S Q :R QR 0 04 3[;S1;#@  P2 cp,QP JR 00B S00 8K{8  R{ 3Px0S P0S/S@@[ ,Sl3000x3 `Vd P_qP`P 0-S  -S+S2 4 R00P40 0PP P P0>40  00A S P :Q PR ,R0S40 L2 R @B00/S0S  0P P P02KCK03K 00B SPQ :RPQ[[$"B20bA#[000xMR RV000 00000 0 0\  000C SE  08@K@P0S S0S S0S80P803K043K#[:R3C"[PR42C"\  c 004 ]3[4;S1;#$ Qm X49\0pCA-0@ S P R0h0PTPTQ UJ 0S@Q :SP4p@W@UW71UPaT@@ @+ 0@T0S0 @0 0$@@@@@BBB0@@4@@8 <@AXP A)P Pp@W@<@P\49\@-`PMpPI l!@0S:?C:0S@A81UWt1Q" PP#00 0U W0$p(0 p$0  aP0 P00 0SЍ 0P *X Z 0P0@JpZ0 p949`F@-M @0S:?C:0Sph0 R\0\ 0SЍ␀ppZ0 p49<@-M @0S:?C:0Sp 0S@0Ѝ␀pomZ0 p09-L0L0S   0S0a\1Q:09O-QM  0 LLP U `0f0Si $ 0S@; @ @P30! Q- 0S05 00!^Qpᐅ儵00 S! l0@0W*P0PS 0e10@0!R%0d!R 0$S0000 SQ4$0P$S4`` 0lS0 008 0ATP8 (@0$00 ,4 $4!@ B 0P :0S B0A 00 R ЍP R D P0S 0P0 0 0R0 0R1 0 0R 0 0RA0P3@ R+D!PL n0+`UEE`bpF0^ W0( ^-0^1 7 0pG^ B1 R00 U0( ^ 1 pp0^1 R[11R G/1a1P[ 8 PT 8  V1dA x1!0P8  000\T( Q00 0S  T *0 0S01  R 0S 0p|P@ 0`T0 R `@@Yp\DX @0`t<|x ;"td -LM `P0 0l3 @T@   !0S` Q0S00Z %  "\1pT1 W 1 @1@!@P@818!` 0S 00b 000P 01  0S\00k000P0 p000L00@ 0c0nЍ49|tx;< p@-$@`@TPMPЍp-p@-@R`P 0p8 \npp@-@R`P 0p< \npO-dMP0 @( \ ' 0 S 0C0\  Ru p  0nSW  R p%R$ 0^ #^ -^ 00N SE^ O^@ z^񟗕f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f Pk f f f f f f f f f f f f f f f f f f f f f f f f f f f k l m n f n o (p Hp f f f dp f f p f hq pq t t o u tu u u f f f f f f v w q q q f o w f r $r Dr `r r f r f r s s s f t t 8t @h D?XV !0000C00N S?X00N SE^ g@gz%^J  J@P0R@%S `dV 0nX5*W V 0P6   np$Q!  0p    R 0\S00^^ _^$  $ 7^ DdЍ P@ 7p 0S$`V PH ? nY*W U 0PD   p+00 &0`0? 2c" 30l cPX0?OT00S^@ϰ@e``|OT ET ȐtET X?2c10!0cd1?Rc10!0PcET PXNET  0 00b BQ`XETs X 0Ca0 10ac  `0CQaOTZ ETj ̐ET} OTO X0v^ P  xgfffT<Q$I$Q``^$ 0S  RT0!X0 Q @`T 0nXP_*W T 0P   pV $Q  0p   FT QP$00$0137 0$@`T` 0`X**WX T 0Q   c0pP$\113377; 0$Qp;$ Q T$ 0P808#81 0$f@`T` 0`X*W T 0Q[   )0pP$\8088#801  x pj  0nT*W   pXdB @X$P U0Ӝ00$ 0l  pW U 0Ӝ00$  0pP ?3i20!0Ui 0pd  pP  pP  pPF?2c10!00cd0/Rb!  PbX p 0 䐒0S yp萐0Sܐ0S2 gp 0  apgP$|` P 00 0a%XQPE0&o2f10!0U03f20!0U00[ό_|6 /A!b10bc ``PH ? aY*W U 0RD   p-000`f 00 P' P# @`T0lX`*W T 0^+   Pp$P  0]p y  p  pP p p Pp@-M@@BЍO-0MSpЍP"@0S:?C:0SPUi @TO`VE 0S AXh p@ `"D 0+S,0C00000 $0g0(,Y4@4 p S 0R0+S*0C00000P W`00 0 SdM0 p 0R 0RsP 0P0PPPPP4 PP )bw8X 0@- MRP@ 0S 21C0 1Ѝ0J R@- MR@P6 0S3 ` pV@  Q 0Q3 ^4 Ѝ 0T0W0Q0T S Q 0T0W R0W0S0W0p@-P@U `Vp@0T0pP p@6@ 0 /@T pPp0P0PPPPP PP X O-1M PR Ѝ$!@0S:?C:0S1 R 0S R# `V PPdU qcX@*  PPdUX 0S z000aEL0 p8@-cPMPp@Ѝ0 R  @0S:?C:0S` R 0SK R PA 0S L0 p@`ya8E-cPM`P@Ѝ1 R P!@0S:?C:0SCpW. XA0T0 P @D@ 0 =@T PA 0 SڷK0 hp@P 0p0ppppp pp a8X @-@T000P u P qP m@j@-`QMP@ p R) 0S8pFW5"z3P 0@p00 00Ѝ SPV \0VK0 p@00tS0000SD9 @-0lMS p ppP QP @  lЍ␀H K 00p0K0 g H < @-@PM @p p  Ѝ␀0 J 000J0 b A-<1p0J` @0S:?C:0S@ 4 P1 00000 0\: P  0J0P 0S X0J0 RPJ0 p`@`t@-M @0S:?C:0Sp ;@fx0P0yJ R X00ЍⰀp_0 p;@ E-`,MPp @0S:?C:0S 0PP`p@ @ @ g0P03J R `00,Ѝ_0 p0- $p@-0 M R!  @0S:?C:0Sp l0@bgt0I0 RX00 Ѝ␀pa_0 p<- t@-M @0S:?C:0Sp 0@@ @`gt0I0 RX00Ѝ␀p%_0 p0- @-M @0S:?C:0Sp ;@ex0P0|I R X00ЍⰀp^0 p ; G-M`D!@0S:?C:0S@Q@T(  0["P 000@Pp@0/I0  @0 0 0 S Ѝ0S;X0<P@ I0 p^ $;|G-M`D!@0S:?C:0S@Q@T(  0"P 000A@Pp@0H0  @0 0 0 S Ѝ0S;X0P@ H0 p'^0(;, E-`,MPp @0S:?C:0S 0PP`p@ @ @Xe0P0~H R `00,Ѝ]0 p@<8TD. 4H@-0 M R!  @0S:?C:0Sp l0@et0?H0 RX00 Ѝ␀p]0 p<@8`D. 4@-M @0S:?C:0Sp 0@@ @et0H0 RX00Ѝ␀pp]0 p@8TD. 4<O- ŸMPp0dS0000S 8 0sPЍA0SA 1!0q0 PlQgG000 0P @t`(  0 "\, `bP T- 8 ` 0G0"Q  t R  0G0   ePt0 h0  \0  008X0 08 p8 0@0X9LHDl<hO- ŸMPp0dS0000S 8 0zrPЍA0SA 1!0q0 PlQ~"G000 0P @t`(  0 "\, `BbP T- 8 ` 0F0"Q  t R  0F0   ePt0 h0  \0  008X0 08 p8 0@0X9XTPHx(zp p p/1H@-0M0PS@prp p pЍo\ `0rp p p I\40F0 bp 0F0 bp H9 @-@ M  @@ @P (0R ЍPRA-`PfM011^o !1V@@ A218 1aP-0`dH !18 1paP0S)  uaNm0p03V0SpW D!1Q0pfߍp 1FP0 @Ta1p0@N!1CVa1`b@0v03P0Sp 0EP0 @4a00@E<4J^@F0Sp02d`d @0S:?C:0T`03/d8p p/1T~( <p p p/1H~@-[pp a[@ p/1:~ -L,McPU1 Q @ 0S:?C:0T@` @0S:?C:0T@0S 3/M1q@PPU᧹nET0J@ nT$XTH@ xp p@PCXQt 1 R000XT θ@ Ҹ1H8Kȸ@ĸPƸ@0D0 P@ L@ H@ PKP<@ @@ X 0S 3/ 00X1 (K1 `0 H0S+LX P0S 3/P`p G@0S:?C:0WW X0S  0p<< 80L4( $0L89 <9x8,p@pP p p p pGD b0  p D b0 @- p p 0D0 b  l@-DT4 SကXP0pS0X@p p/p-p/p-p/p-p/p-p/@-p p 0jD0 b  h@-\MQ  00 1/Ѝ p p 0OD0 b @-\MQ  00 1/Ѝ p p 03D0 b P-0Q& 0Q"0CQ ~0Q ʨ0Q" 0Q 0 D0 &Rpl0Q d0Q} T0Q L0Q@0Q8T/'h$x$STBSFXsIeRP- 0Q ڨ0Q ʜ0Q 0Q 0Q |0Q@l0Q `0QT0C0 &R80Q 00QF3NTFSJFS1sIeRTBSFX{QSTP-&0Q ڤ0Q ʘ0Q 0Q 0Q x0Qh0Q \0Q T0Q/Q<0wC0 &RY)SJAE=(NTFSDMur0@- QM  Q Qh@I,Ѝ00S!PC 00h@Ih@I]Q/D d d l l t t | D  D D D D L L D t  IP0: S S  IP C 00 IP T0B0@ PIP$,00 &R00P|d@-P,M@ ʊPB6 p,ЍP Ttꤰ ܯ ̯ X @ @ 8 8 H 8 8 , P 8 H 8 8 ` x \ P ` p ` 8 8 8 8 8 8 8 8 8 h 8 8 8 8 8 8 h h T P h 8 H  H ԯ @ @ @ @ 8 8 @ @ @ x H P P X p x p x 8 8 @ $ ` H H H H @ @ 8 8 @ @ @ 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 @ 8 @ 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 @ @ 8 8  8 8 8 8 \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ P "P  B2 p|p pPu ` p pp02A0 R pQ(00$$0L `$0V 0 SS cDQGPӛ@LQLR RA 00{ywuxsQpnl*RiL0 `07A z402A0 e a <G-1@0A $0S, 0p!40RPb0ij00 0c0S@P  0R   0RPP0ijP `X 0  ^0PP ^ V00  \PV 0S P \* 00 @- \S@@\HK@0,@0\PX0#10I0X4J80@-0 $0PR@@T  0@0  0 0\0eP PP0QP0@-P@ 0^1C 0^ 0LJ 0P 00-0S0S 00!R\10S -Q0^0C^00 0S 0 /@90S  S /Q 0S0S 0 \1 10

PJ RPp@-P0@SPa0P 0P P K0S P $Pp p00 0/O-M A` p W0L P XPI PW(0 P 0!  2 C 0@SӠPP   @P'pPWWP W0APP|@pW庻@ЍmP 宻O- M@0`S p;* 1p0 ! 0W;<0 $ W! 0020 0 1 21C 21C  00 Ѝ\0Sꄰ TP Q B@ePZYPU 0 P@-0A0Mp`Pp 0+;"+<40 0 R 0   qЍ  0#$+;"+<40O- M0pP`  2C 00 p@Z 0!!PQ`P0 0 R 2C Pu PY 2aC 0@0L1 Q00"!1 10C A Q00"! @# 1T0#4;#; Sq P00 gp@ P Ѝ WpP P  0wP 2C @@0 R  5p@ iP{ 11 U00V0S0 UPO-p  A 4M$ 0 PE0 0 A00 SW J  ^E `S2  00 R0 0`S0 P2AC0s 0`S   R00 S 0 0 04ЍP P    000PU  ^ 0 ! 0  0PP000@-0@S 0 p 0  0@- M 0PS@ ܿ0P0 0  !Ѝ0 0 0  G-QP6 RP,0S)ᶿP`p  @V0W;0 !Q0p!0`p V @ R@P GU 0S G 0 0 0 g  !%00@g0 f  !00@f@G-P0 MSPg0 $0@RppW*`W$@\d" 0 0 0p6 0@s60 !@0DT@ 0P0W @@ ЍP0S^&@0 00 0 0P 0Q^  0bp0 @00Q000   0<E-P80(`S0 M0ո0 @0p0 p  PQ( 0R 0!r \W P0 S,0( AF0_T@@P@@030 0GsS񟗚< P T l L h (00 0S (0 F0( 0C BS(  0 0 Ѝ0 00 < S00 (00 \$00ƥK0Sf0 0p0pP0SL(0 0A)F0_T@@P@@030'0GVS ` H , x ` @  | Dn3@ R 0  _Q  0@030 i 00V 00Q_  00KY 00F30S00? M00:30S003 A00.30S (P 0%0S " Q -0 0 < S00!; S  < S00 < Sz?C0 0 0  !  00  00 "00 < 0  @0 0  !00 #00 < 0  P00  0 0  0 0   1 G0 0 LP00   00  00 A2@ R2 0 !_W  @Q  0s  0R 0 r L0S  0 0  }\00 $0,  00 r,00 $0, <0@-MP(@|(Ѝ0@-pM@`P 0S" ,PS S00/P0S 9P00u0S 1  0@uP  U 0PSPЍ0P@0@-QMP00S1 P0S 10@At0Cq<Ѝ0N0S T 0D"1 31 \M0S*D_T00P0S  0@-00CMPS $ 0S Ѝ0 Q4 Q* @00S "131 @00S X $4?;8 #    1T0   T0 @@-pMX @bP`U&T0 @\ 10 "$?+(Q"(R         ЍO-P0,MSP00$ JS00Q@J 0Td>@\0 0 p0$ 0S`$ nDPw B  V  L0S0@0DT@ 0P00Td @,Ѝ@0SL0ST=p`0 0SG 0d0 $E0SpM$`DP) MB` WO  0a@0DT@ 0P0Q @@ j0 a0\I 0  01@"2z80@s0 0w0@9P^Zp`00 0 ^00 P0S p+0@sd[VC  0P 910 (0̃p`q $pW 0SDP 8 L0S T  0! T0L0  00 S0Q 010F" 000 Q0040Y80f0 080$0 0 R @  0@0 Q0L R 0!0!v@+개E-0 $0RppWP"``V  0@0@Q@/ R 0  0@ 0 S0!:0`V0h `0S 10D00 $0, (00 (0<01ؘܘ0@-$M@PPdP $˺P P dH0S P0SЍ0@@0S Ѝ0P0Sp@-$0PS@h` Q Vpd0 f! h@p00RPpVpO-@,MPQJJUP" U\L0S EP<\  e!0KP0 peePp P0000 80e0e\800H0S0(0,ЍP K0S H0S]@0S @PK\000,0P4 000pP8 Lp<pp p0L0 S =Pp\pI0S [`K 0l0R 1R 0 S 00S`FR`0X$000pf  0 $0@s `X$ph{p N0S [ 0<0pWKP plM0S00p  0?`1U QU`F  EW00V0S< Z ,04 0h0 h 00V08 L0 1 0Q 0 BS`YFV!0s! 0s Q`ppPK   e3K! 0peW p  01 R0 0@0SQ pD"1310 ^ 0K<0M0S00  0 f$ J fP030#p0S= *@0Spp[@0h0 0 C<> ea!  e0 peeW p 0 ` j!QPKWP00 $0$  $pa{p,04 0h0 h 0008 L0 ?P_[0 01pWKP  +KpO-M\pT+P\'0aP0 R RP032 |0Y @l | 01S `| 1|\Ѝ{P| O- M\ P$  1 RD0 0 "!Bp W`@T Q@0Z400 S(hP  Ѝ8@Py p Px40 0 4 (p^G`0!1! 0SP  "4?;8 s 3#X\00S*40"!"  02\40/ \1 \PU (0W.      @ 0cE   `^ $PTP4004040@040 ㋶P( 40 0 40 0P0x?O-M\ P  1 RD0 0"!Bp W`@T Q@0X P Ѝ8b@PH P UPM(PPU5p`40"!"  02\40" \3 \  00S 40040U11\ 00S 40"!"  0240400U40  P TP 0P040@040ᴯO-$M0T  p% "10 0t0 PP@ SP  00b R8 d0q0P A( `?P 0S$Ѝ  r00S0> d@-hd0 RP  P 0"!B `P@H0 =P @;00 PU/P G-SM` p@0 PS0 0 0S  P0  # Pp W@ЍO-p4MW@`f PZ2 0Q. 1s1 P &0 sP0QW PUW P4ЍUڀ@0 R  0 RP(0S2,0S/\ p,6*0 $\P 0Z`p `n@ \h 1  RY 0R  0S P #Z 0pq\ 0W 1W  R,0S@,0S0?P@  0P R U P p$(,(0S @p `(0S 0  0 @( qP(lP (ZD Ud0`p`W0 0000 0 !0W 0@YY 0R  0S ^    0010Z 0P:0 Pf \$@T@ 3)0 `0 0@, @4 80Z0j+Z R`\ !00^B  0S 0S1 1140 $0< 0T@  0S40 $0< 00S 0!0#!@ T pðP `徰PZLt @ 0 1 61 T P  0RS`@30 $0< 0S@=  0S 0 0 @ T30 $0< 0pS@ 0  0!0#!@ T   0S30 $0< 0S@ 0  0!0#!@ T  0S20 $0< 0R@ 0  0!0#!@ Tv  0S<20 $0< 0 R@ 0S20 $0< 00  0!0#!@ TKZq @ 01 61 T>  0RS`@`10 $0< 0DQ@ 0S(10 $0< 00 0!0#!@ T dcc cc0Tbba8ala|`` _0`p__^^0^p^]]x]]\\p\\(8[[X[`[ZZ0ZpZYYxYYX YXXO-MPp n@0j P T`p @0S0 000pP[Q !0!!Q@0S1\0S <0!00P00 p 0 @P( \0S"X00X0 0 ` P  0Ѝ000 !00Q0 ᬢD 00ᣢD pD 0 0@-PMpPl0l ` (`ឯU@ T mЍ: E≳00 pO-dE,M@P P $@T~ ,  8@0@04PYPi Y},Ѝ00 0cY`^  0R   0R ^^ P U 0 @ 0Q^0 0iQ+ R00p@ P@^R  0 0 R @0 b4P0*  P* 00 P0@!0#! P|0'0 U $ 0 Sw  X 0@&0QU'` ePU@^ 0S&^  0R 00 0c PU@^ pW0 ( 0Q^00eQS+:Q00(  Q^V &0` 0R 0`P (@ b4Q0: Q* 00 E 0S 0`1_U0` 0$@`  TP 0p 0 S 0  R R00S Q 00 0 0P0 0@ 0TU` P  D 0D` 0R0P0Sj ` 0`Pp \0S^ (80 SW0\T 0 |P 0y@ 0PT`D 0`0] !T0S P00P0 0\`PX L0X 0 L0X $ 0N`PJ \0SX00X0P 00%J0 S @0D 0DP0 S0`0 0!\@D$43v #\@DX$X4&iD0`0p 0Sp& S & 0 v 3(00D0S  RT0 0S S 0`00,S@  pw wW  VT Ps TU0S3 w 0 0 %PP% @` 0\V@ 0   PP WY  0P u 3`D 0`0d  PS(l S@@Sp  Vp 0,SuT P`  0PVP TT  y 3 `c |k` \`UT0 5T0 0`PPD0`0+10 $0< 0G00 0 * 0P0f  0!`PpD 000SDD0 0``00D0`0D 0`0D 0`0D 00\?  8O- M4p0`P @0R0P0S.  \\ 0  V \ i 0R0P0STP T@ \\  0  Ѝ 0 @P 00@O- M40 @`p P0R0P0S *  \\ 0 X \ 0R0P0S 0PP 0 S%  Ѝ 00PO-M@0 0@00@|@0^ 0@  t0x@0& ᷠX@ X*@A ɟ D@0 XQ\  :{0X \<1 S000\X0X0@:<0 0S 0S @|@@T P2  0 X Pc0S 0Sa \0S \04 <0Q ʁPP80X@`|@@0l%0 0 | |0P S P R! 0U@  0PT@@ @|@  P4 `0 0@0@ 0S{ 0Sx 0Su Ps P 0S 0 R4 nQg R !R0S:S[ 4 uPH4 oPB 4N4| JP8PQ2pAC 00 R PQ2ACW$ P0@0 pR  0P00 Rt`pP @ |@0|00Ѝ00SL0S9 @~P 0S/ 21C  Q Q  2qC (S@1 @pb @0 R R:0|0X \0S 40 0A H0JPx"L0Sp@T ptQ1` R# pWx@  0P$X 40(0,8tԘ ||@Tu\0S|TP 1 0 S 0RP 2 1C0 PbP0A 'p@p  0 ( 00,  (00S ,0S PxX040 НP0<p aR@ᴙp<0 P$@  T0Sp0S20 \ɤPX00X0 | * UI .C&@Tp P` ! 00C S0d d e d e Da pe d d d d te 0SP^ PM 0S00@0SA* 0S0S0ҵ 0ó0µ@<080400 R &R` 0S01SP0 A|@000040PP } 0 A@R RXV X L0XS000 \ X @|@d44 D ̵ ,@-pPM7 a0S P@@j@P@@@ @@@0S ɝP 000垤 0xPЍd0d!` Ѝ@HH Ѝ@ 0 R $ Ѝ@\@9 p@-h@0:0 000 0 P0! @@9 p -LMMP T L \0X! SP! 0D #;0D1 T1QpH Ts T TTQ TF H! QH! _T!L 0 Ha1\1 0@T\DPX!Q@X1 P 0H L!\0SG00 c1q\1@  L0S 15%0S\PgL0 4^ 0@0AL1 0S:@gNK0K 04 8 UT TH! QH! (KT!T1@ \s0@!X@P` VP@p 86` D0Q0 0 S:0 V0P@p@ Y@  L1 p 0S 0X \p0 0S$0Sv 3|0 $0S @,`P@ TP 0SX!0D0X1Q 0 SD:@0 T0P0SPNK8KP 0 L!\0S 0u$  <p8![X000PSq040 80 a *p 8A[X!0D0X1Q 0 S:000 SD:00ꘁ0SM 0X t0SK 1X (0S,0S 0+$ p. X00T!00 00< 0[X,㽦P000X,㴦T@@0S 1X x00 00<0\00 00<0@00 00<0  $p$""|"!!!!p@-`@P,| $M( $0S  E$ ,Q  >$00S  6000p@-0000P0 @M ``pᗛP P! 05`000000@ l 0 00 0 Z 0PP PЍP300 -LLMƟ^H@K` d h \  D2CQP@ O \@ h` @P  QH`<@ 8@ 4@ sPT@ 0 c X X P @0@ 0@P,`q 0S~ S TY d0TP "0R0@ d )Pu\0SN 0 S S/0S S S/0S //0S 0/ PP0Q 9Q S00SS0S 10/ P/ 0R3/1/0@-PPM @$"TPЍ0P@-@T M0@-0 S4MP @ S 4Ѝ00 Q 00 ( 0   1@PQ 0R  0R AQ 0   0W0 W WK 0P - XT R` ) 0S @ WP Pp& 0W@ڇ21C P`E`V@PE0 4n밴 RD4 P 4P |$X0hUP0☰─0L40PP/ @PPpP   P Tp  &pp 0 0S00S  p@~ 0?Q00Su ކP @p000000 W  R  0R`ph P00 0PPJŸ 0R  0R 0R 0c p 32R 5 2 0|20 $0, `20 $0, D20 $0, $20 $0,  Z =sЍ0S @ gP PpC PW@ڇ21CP`E`V@PEP  0~@Pp`10 $0, 10 $0,  SpG21C 00pG21C  (00(P lxX4( -LM`Pp4  0*S W 0*S  (K0Sp |7X >0S 0S`0v030.0K80 <0 -0K0 0S S W 0S0@0 0Z4@K @SS Sg@0K0 0PPT9 0S6 0S@0S#pFp6 S  X3/ 1 0! c  8 b P  < 64PUP  `0Q  p0P儀  0R 0w0= R0 S4 0K 0 0 0 0 j 0D0  d Pe X5$0 0aR S0S 000S R  0 0`S PQ00P儀p0 0 0ppD0 DK Lp ;D0H RLKW 0 0LKH0 Q 8~"<0K-K.K8 K$0 ? 0S[-P[U.0[S6 lK @U PP hP )10! c0 @ D K PD0 0 0 Sn S R0S 0S0s0 00 0|4S8}~<c峍PH"10c0 VAV0V VV0 ]SN S.0[S w pl2 RL  T20Y 4 00 S 004 0085~40S0Z  .0[Sm8 R 0K 1<@00 KP00 -0[S@ TTT!T1%8~]P 0: S* 00<1s Oo@0 `00P<1s  <@0 `0 h0 0 O 8 @00 P,$0;@4@TO-|M 兇p 嬠@`P00W ያ@PZ 0SS 0S PȆP pÆP `徆P 1P0e 0 @T4!>z00r1P@8 0 CB/00 0   P 0: S00 S40 S|0| 0 "0|Ѝ0S D0 0 00ꘂ,;P-DM~p3DЍUp p p/1. p p p/1x.p@-  < `R00000 @ 00@  $ (@0(@,P0 08 <08 0@4PD \0H0L0P0T0X0 `@p@-Q,M`$ Q QpP @P1 P@P| 6p p  ,ЍD  00,p(p$00 b TTT@-,M@ 6p pp%P  0 0 8 4  _0p0pppppppppppp,Ѝ␀0 `0Mp T t T@-p p 0:0 b  訯0@- MP P 0s @0s @0 @ Ѝ00@0s0@0 @- S M R   Ѝq00r00Mp p p/1|-0@-h@M0PS T0 RU@Ѝ0P@@P&6p p p/1T- 0P /9- M xP ЍA-bMPPEp`P bߍAPᧅ@V 1 !xT00$  ,U@-@p p@/1-8 <@-@p p@ p/1-@-> pp  @@ p/1, 0P0/D0@-0PM0S @0 0 Ѝ0L@-0 0S I0 pPh1G-dR ?P1 Lp@Dtp4Q' 00aS,n &P``]p 160@ |0[T0 `0S00W0@夠tpP00l 㝅0 @t0``S\n X0 yp 00PLT4HHO-`|MTOlp@PT$0S1 4p l`upP 0 990dt`HP@@e<ğ04$PP sDPP v00S  0R:0304 5* 0R 0304 5*30x  0M`Jt#0  pl 0fX T00R SH3 \070`  TT S@@p0Pd0hP#@0S:?C:0SB R> 2 Rl00l00SB0m2 Ryp70S w|Ѝ`rpl 9P0S "2 0S pl 9}P #k&k;11U dG0Sdq  )w!0S0PQ7Plf`<` T1@BAa0!00c00T0l l ˇ]0 0 e`@l pPR @Pp  9[ k30 tp|%b:kPvPdL~DPHLTX|gfff0  -- M 0  ЍЍ/--M 0 Ѝ Ѝ/@-`pMPl @0S:?C:0S Ѝ@@(@-p @0S:?C:0S<0< @@@HP-P@-@ʰ %Vp p@P p/1*P-P@- J,Ơ%F @Zp p p0/1*0*[p p p/1x*}p p p/1p*p p p/1h*@- @Q8  RQ 0 0 0R0 0 00 0 R 00 0\ 0\  ^ "R 0 0 ^ 00 000    ^ 00 0000000  Qp@-`Pp@T 5/Ppp@-0@S`P  6/P   6/P   6/p0S6/pPQ/ 0@-@MPP P 5/Ѝ0@uP/ -LMM1Qp(K@Q4 (` A@U4@ 40@@`Q 7/PP V!^00 c Ն0 s 3SQOR V 1 0  0S P00 08VwQ 0u 0P@\q 0 0 0 ` 0@0PP^9 6 0S 06 0 00 000@ 00 0t4qPP0@ 00` 00P 0PSpx V00 c  8 _80S 0 0 0 00 0 00 0@ 0`F0V 0Q 00 0 0 0 0 ` 0@0PP^  0S 0 0 00 000@ 00 00S 0 0 0 00 0 00 0@s'O-QM > R 0P0 0 p@`PR  @;/pP  0# W@@ R` z`P ` 0  0T 0    0Ѝp@-MM0*`06IPP# 0@990 :@D  X*P  lP?0P*A:F*q$00&  Ѝڍp@-MMH@P 0`99 P0 XP  ǀP000C S`~FЍڍthHpP` 0`99 P0꬀P` XP$ _F0p@-MPP`" L@P 0Sx ⇀P@ up 0T 0S`2@PЍp`0 0Pd/90@-PQM @T /ՀP 00 @  0 Ѝ0XT@- M` @ 0p p P@_0 Ѝ00 b@P @@-@p p@ p/1Y'>tp p/1P'( <Hp p p/1D'@-} pp ]@ p/16'p p p/1,'p p p/1$'=tp p/1'( <Hp p p/1'@-I pp )@ p/1'!p p p/1&@-0@0f 610$ 4"R*10P  04210 R 0010 @\00@-@' 0@0 h008#810$ 4"R*10Q  04210 R 0210 2!00HPPP 0  0 00 $0 꼓Ē0@-@00@ S00 h008#810$ 4"R*10Q  04210 R 0210 2!蠒@-0@0 l008#810$ 4"R*10P  04210 R 0010 @00@-@' 00 h0 08#810$ 4"R*10Q  04210 R 0210 2!00HP|PP 0 0 00 $0 LT00@-@' 0b0 h008#810$ 4"R*10Q  04210 R 0210 2!00HP:PP 0  0 00 $0 DL|00@-@' 0 0 h008#810$ 4"R*10Q  04210 R 0210 2!00HPPP 0 0 00 $0 <Dt00@-@' 00 h0 08#810$ 4"R*10Q  04210 R 0210 2!00HPPP 0 0 00 $0 4<l00@-@' 00 h008#810$ 4"R*10Q  04210 R 0210 2!00HPtPP 0  0 00 $0 ,4d00@-@' 0Z0 h008#810$ 4"R*10Q  04210 R 0210 2!00HP2PP 0  0 00 $0 $,\00@-@' 00 h008#810$ 4"R*10Q  04210 R 0210 2!00HPPP 0  0 00 $0 $T00@-@' 00 h0 08#810$ 4"R*10Q  04210 R 0210 2!00HPPP 0 0 00 $0 L00@-@' 00 h008#810$ 4"R*10Q  04210 R 0210 2!00HPlPP 0  0 00 $0  D00@-@$ 0R0 610$ 4"R*10Q  04210 R 0210 2!00HP-PP 0  0 00 $0 HE-M||0p0 `LP0`PP |W@  $~Ph0010$ЍQ /0 03S*1 0Q  00210 R 0210 2!//@-0`0 MpP@0S PE0PS@ {Pl0010$ЍQ/0 03S/!10\/ 0021 0 R/0010 /-2# @R#*PP3#@-P  @0S:?C:0S  @0S:?C:0S d 0p가-0MS  Ѝ0@-0M<J^@0 S @d 00S:?C:0T0@-6 R 0  [Q pPSQ *P R 0  !QZQ cP=Q ]Q 0S  R 0   `dVk V~8 {PZ$c@@ Ry 0  =QgR @R 0  Q`X R=Q ]Q Q  R] 0    fR= RATc{P<Z10`v& V  P%  0R  p` 00` P @0S:?C:0T00Ѝ@0lK/ 00QPPU` -LMpP` Vp@x1  00S `10 R0 (KP1V10 QT*!0 c`P R0 e00  VpP P Р@Pb`F l00 R 0 S U@ Р@T: РP@-0S  0CS% ȋ ̌ ȋ ȋ ȋ ȋ x \ ȋ < ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ ȋ   h1 `1A0SQ<1^\   (1A 1 0S 1 0S0 @0S0.0S0.0S0,0S0,0S \0 0S D0 0S ,0 0S܏:99&9990000/&&A-BM0S q*BP0"0S00|g*jtd*P0d"0s030X[*P0H"0S00<R*P0,"0s03$0I*ŸPN 0SJ 0SQq0S 0S05*PP @` 01P c0UP TG 0SM .S@TbVd1`P ZP1L1\ @1^ 01R ( 1R$ PЍ0 Q000S @A_P-*`@T:>P *` 0 \10cc9<9DT9`9l9|9܏99999Qtd@p@-V? 2@b C^ :P1 P L0 0cS8^*O-ßM\P 0  @@@VpЍ0-M,P %K Ѝ 0@-@0@ P<0@M 0 @/Ѝ0::|0p@-S`@Pd0 \0 x&T0T `P0@P s p@s0S0 L&::` @  /  -L4MpL /|WP /wWP 0PS@ /lWP /gWP 0SW0S 0RR 0S 0R3 0 K40K{P H #Y @ P0S >!PP@T426QPH 600460H L (K 0S60 \@W00 cp [< \ 0R,60 \@W00 c [ \h00 c@00 \W00 c \0@,S0,S S`[ 0S ,S`,0C0FTQ 00%@ KP;Ym ş0 S 0 S  R(M0 0      4 0 0,S@@0,S S `0S ,S`,0C0FT <<$~KP 8$$xKP@@  Y PP0S# hKP 0S(M 0      @g00 c@0 0\p(M0043 0$3 000H040H 04 2! Z40S 0HD0 pDD "P 0H 00YT P04 0S@, 0S)00 0 P"K`P@8`  R 008K02/POP6 00  008 ` (0S#  0SPU40D 0CRY*@000000&BBOP 0 0D40SD $0 p>,&,:0:0<`(:L - L4MP44 0 ־00@T0 GP(4T0(K$0S 4 Y^ 3H <4pL  00 c@ S S0P<0 80 : 0990@08K<K 0>`P)8P#NP@q 0   0  U Q 0   `0 @T0 eRX R> 0@ 8XBH 0 H0Y0H0 BD`K] @T 0hh"D0 P @AT``` `0\LX L0P8L 80D$@ $0 d/ O-DM<$  p@P0 0 Tph Rh0l@$0T80l t08p(( SA 0= h@Th>`{0  00S0`0Ut:@W3a: P00 U0S ?0> $("4<", 5!S 5!*0@ f0Qa 0c000$ ; `6@,@,\9 U`@Z @U:W!!*0U:W:@0 $("4<", 4!S 51*U@@h `R6 ` DЍ 0 `,0,\U@` @U:W!!*0U:W:@0#0 +3("S51h*U `@@h R @T P  `0@T 0 0@ 0fX"*0 40l t0@@ 04 0 @4/P 40S0c?AP6`\ t 0R0\0S 0c^~U 0 0Q  000000i( R* ( 000 ` `t 0R0\0SR @`@`{`l@8 000t 0R0\0S< `@i(0SN L 0(00#`\`Y(\' % 0@00h Rh0 000h h lt0@ 0 0@ 0: h Rh>`r0  00S0`0Uk:@W03 05c: P00 U0S > ? ;%8#R5*0@ f0Q] 0c000$ A `<,, R? U@` f @U@13`1 5_: W 30#@1`1 5!! 0%*S0U: W:@  ;$8#R5 1*U@@h `R= ` DЍ 0 `,0, RU0@` 0& @U3@1`1 5:W@1 #3`1 5!! %*0U}:W~:@# ;8#R51e*U `@@h R @T P < `0@T 0 0@ 0`X!*040&lt  @@4 0 \ W:0S<0L0 PLP?0L<<\0b!000e0SHL00 P0 P0 00S0aL0Vk:HW,P   Q00V0S LP PR8L ΔHL,L Rp 0b QU0 b00 H @PT 000W < HD0Vc:D 0PS\”D HHVD L0RJPCY 00C 0#0\, PUPU %H 00L @ P, H $4c 0 0,00H  H LPH 0,0,0S' ,Q@RE 00 Q W03,05:0S10H00H0?0A<<Q0l"#000[8T0 SL 80 ` 0b00 L08 0cS3S600L8 R 80 Q L0\/ PU 8 0L0H  P,PUL,"2ۮ"2֮"2ѮL,0 0,00LL\ @04 ^@0@S+:0S>0D0 D ?0 N<<^0a,à0 000\j @T DPC0H 0BP PS@T<O 0 000HHV`0 0P0L , :!1iQ 0000,)( 0 0P $0(D \Ld L06HD H  dt/0@-@M LP$ 0P  3/PP $0$0Ѝ0$PP @$,$($0(0|E-0MSP \"@0S:?C:0S{$$"DpP $0S s` 0SnЍP= `6A`0Sh VJ1//pP 0 000000000,0 : 0Q @pP$ Q ; x:Z  O;@ ` (00(00` 0 JP``|@ ~8P``` `0WǺJ0 px4&0& ,:(:`G5O-40. DM hQD l0P1(q0 $! e: $ $  00(0!0(, 1! 0S R RV l0SD 1 l0S, 0Q(%$%*(  $0 S2ݤ0p@4QU,1S& 0Ql&@&|&Qx,8&<&A-pM1P@ pЍ p pp]p  P8\p pa 0p@;Tp' p81 R 0S*R 0S 10R:0R0R#*@0S& &0000P,P0 T*  d᧩p@\P&00L00 g  0 0:<&8&$ @&c0 尰H&D&- 0@-QQMPP@l0 T  0S0Bs0P PЍ00S0C0 0کH&4Hp@-M0#<\pA/ A6`@0T ^ T9*T 0043 a Q 0A3 0  0a430 0# 00a0^ ^P#0!:>l p00c 0C# c4! c^P P004T00ꤞ@-` S pp VM@P V% V ᆏ00e@PЍ0!000c@Re0 A e 0 A e0 $B e 0 $B e4XO-,MP06^Ɵ0 SP` Sq @"Vh&0P 0 @0 !0L S`p* VPS &'(  (" H,(0b A2!0P0c`Rh ^( 0U,K 0L S`pVP( &Ƞ'( 8(" (2!0R0c`hP ^X000h,Ѝ000h PRKPQ@   n0 Q n N0  ,° hQ@   l0 P l@0 @D@00l0  h 0P:Qp 0@ c52 b1 R60Qp@ @d@'(8( 8"Ȝ!80 d0#H+8"(.5>< ^60QS0Sp  P0 Sp   @Q0 p W%pk "%'Ƞ( (8 ""`&H+(  ("8.(Q0Sp P0Sp` Q0`p0 W`"pk S@<6^P%Ƞ( (8 ""  H+(  ("8.(@Q0S T0S  \0 R k 2!71"@ @$0  0l5 \Q P0!x#h(`"&.+(xhp("8'(@P0S T0S  \0 R k 21"  0kX4P@-M@ R0 R0Ѝ@-(M0@( 4( R0( R0(ЍO-,MP06^Ɵ0 SP` Sm @"Vx&0P 0 @0 !0L S`p* VPO &'(  (" H,(0b A2!0P0c`R( ^( 0U(K 0L S`pVP$ &Ƞ'( 8(" (2!0R0c`(P ^,Ѝ000( PRKPQ@   .0!Q .  N0 !,° ( 0 !,° (Q@   ,0!P ,0@1(D,L,0 0! ( 0! ( 0P:Qp 0@ c52 b1 R60Qp@ @d@'(8( 8"Ȝ!80 d0#H+8"(.5>< ^60QS0Sp  P0 Sp   @Q0 p W%pk "%'Ƞ( (8 ""`&H+(  ("8.(Q0Sp P0Sp` Q0`p0 W`"pk S@<6^P%Ƞ( (8 ""  H+(  ("8.(@Q0S T0S  \0 R k 2!71"@ @$0  0l5 \Q P0!x#h(`"&.+(xhp("8'(@P0S T0S  \0 R k 21"  0g |P--M0 0Ѝ Ѝ/@-@ 0 00B0A ^!000A ^0@-\@P M0aC!\0SPЍ00\ 01C0\Ѝ0@ -LM`p F RP K `00 cA ,T! 121*00 R0, T*,0S S Q00 R0, T:00T0,*00T0,: -L M@P$.E 0 ,A d00 c၁+``FPEX@080 A#8 Rq@Ֆ0  $00PE`FXH@(KZPE.Q,Q00.Q 00PEP6@-\4M 0PR%0304p 5* 0`@k u0Q~ 0Q' ,D0$4,0!0 0cQ.00^*@0 T`*\ 0R* pP@ `50s/ \ 0R.0304 5*\C`0T3,0!0 0cQ.00^*@0 T`*\ 0R}* pP@ Qx4Ѝ\ 0R 0304 5* 0`  \ 0R-0304 5?*`0Q\ 0R4 5B*` 0x \ 0RI0304 5/*`n\ 0R#0304 5[* 0`V \ 0R'0304 5V* 0`@L \ 0R+0304 5:+p`-pk `Ipd `9p^ `pRp\ 0R** qP`y @%p`r.pB`k#p`d'|p`] upc`Vop| -CML0ZK  K K4 % 0 pK K*KPSPUl>Ph l0  IHP.0Jn@S  0S:?C:0SH0`HP000K K0nC:K  ZKPU K 0 H 0@CT@ K\ lKd=3/0p0S K K K:K 0p0p 0ZK CZR0,=(-KK1 KKZK, *K P N KX^ P< P) P*K,p :K41K0'岁@PK0^00SK0 ^00S K,0iCA *K ,K, 0`CA <0 :K0SX *K Ro :K 1ZKKP  `0O*00*Kp0p 00 CZR??/ZK100Kp0p 0 K CZR0 ??/1*K00ZKp0p 0 CZR0T?T?P/K1K K }K yK:KAA..ZK aK  KPK*K4 Q@B T  w:K0P:KPZK Qw\` 0R * pPV KK PK  T R-00Kp0p 0 CZR0==-1 K 00Kp0p 0 CZR0==-1 K 00ZKp0p 0 CZR0L=L=P-K100Kp0p 0 CZR0==-ZK1K Kp 00Kp0p 0 CZR0<<,ZK10 p8p 0p 000C S:K 1P:KU4PmK4\00K0 CZR0$<$<,,1K  K !p W00 c  K0*K,0; K0   $U KPe:K0SGK0^00S  KP W 0  T*K4 0g d:K0RP:KP ZKT*Kh RKp^*K1t SR :Kx0S V0  U_KP K0e fR Kn \ZKKQ0iolK  3/@ 0c K0l gH0@H 0S 0 p K0*K K0@ "0@噎p  0DpЍpZ(0#4<:#:AQ 0<0@0SP>08半P A-0MIpHP净0Jn@S  0S:?C:0S]H0`HP000@@ 0W`P!4u0    l0S: H 0@CT@# u 0OS <1I0K  Ѝvv 1<0 R0 0 TH0@H 0S'0 p,0$ 0bOPU`ᑕ0P H 0@CT@ {H0@H 0S0 pp@-MQP 0 a0#a@ "0@徍p  0vЍpO-QP M ` 0Ib H0S 0Sx P; @0pdWrp' @0pd P0pd PuV0Q 0Q@!@1 P @@ a0X@@ 000   Ѝ0P H 0@CT@H0@H 0Sj0 pHP`0J~@S  0S:?C:0SH0pHP00000E0K  0Pp @0pd 5 0P0ᩔ0P H 0@CT@ {H0@H 0S0 pE- M(PX`p,/Z lQ \0 R X Q 0$@P Ѝ$0S X0  Q 0bO`Vp. ~ 0@P0ҚC- MIpHP~0Jn@S  0S:?C:0S+H0`HP000(0, 0 0 0P `H 0@CT@  ЍH0@H 0Sڎ~0 p0P H 0@CT@ ZzH0@H 0Sp~0 pA-M@P`p0 P@@0 0  0>ЍE-0 MIPHpA~0Jn@S  0S:?C:0S.H0`Hp00000 ?p `0 H 0@CT@  ЍH0@H 0S ~0 pq`z0` H 0@CT@ yH0@H 0S}0 p@-pM^`@PЍ0H0PP @00*00$ 000 0p`x< \ @-0 @R00 000 0a000C00@-P`M@0Q  00b 0 c Ѝ0@A-ZMP`@ 0p ax0`1<P 0: 0D0 0@`1Zߍ@A-0MIpHPK}0Jn@S  0S:?C:0S]H0`HP000@@ 0`P!4u0    l0S: H 0@CT@# u 0OS <1 }0K  Ѝvv 1}0 R0 0 TH0@H 0S|0 p,0$ 0bOPU`U0P H 0@CT@ xH0@H 0S|0 pp@-P@@p V vp@pp@-@` l0PS0Cl0 s p0 Ppp-M|P 00Ѝ(@-@MP X PЍ 0< ?P 0S 0SR \&@-@G0S0@t&-40MS( (0 Ѝ3/P\&p&t&( p@-1MSP`8 3/1@T P 0S000 `i. R000Ѝp R 02/P@JP`@ \ @R D02/$@0S000d x&p&t&\&@-!M0R 0\ 2/!RQ 12/PpK 0S @T X- PB00 Ѝ0S 00S P1 \A@% 0 Rp @ P 0000 `0\ @@P-  0 tP1y\pt$@0S0000d x&t&pЭ\& 0>S S 070 402-M 0 PЍP @-0@0C S   0- 00 0  @   @ @ 00 8208P 0 $3-M4 0P{Ѝ @-pMW`\0 PLL0@\@ 0 @@~4 Ѝ 0e-::0@-PP@08  1!0S\0@-0p S`LM`#*0LЍ 1z0 @pW4 S@T g4/`G0@ @P<0 D0, ( 0G` @$PP4@,@0@0`M800<0@ P@0< 6/PP P0@0@`0Tp Kp4 D0S/S/S/0S/O-ϠN0Cl@  ` 20lcM ZQK`3QAP3AQ@#Oᒑ0Ed$"B$3b`.#0?AQc1a0ePc# U!Bb0rP0["Ϡ2l10!0Wh3l20!0W` p2 S`h"ˏ 0Ch3!  1 b0墏HPGHJo#f@g&U03bfpp3p2qpn0 .OCA@ `ɲn an 1/B 1  0ApBPgZ @ l`oF P nP@ fEa 0 0c a d/Bk`p0 S v>G 0C^0 Ϡ72l10!0W  P  @00` 0Ѝ3l20!0W T  P  A0 PE.Qų$IQmn<"O-,p(WB @QLv_PvPE 1Nl 3` ? 1cB AD  b L@ nd@ Pl?C@!BC!` `21C a31C `$0#a!B?^0#S^~N^QE-PpM7/P Ѝ@T T 0d```7/P@T00 0S0j0p03Z0S 7/O-4MpO @d2<1C( @c,  n 0` P00 d4a1"00X "!B2 1C00$00E0<40P 8$ <0;S;0$0Hvό3VL FH#10a0"0!B4 >C b0A 0A1A0a",!B A( 831C$ 0E%0 , 0# B(0@' C*L=bS0cS p娠p* pP` p H$4, (0pP; U0W 0S0\  S00"S`V 0PSpPЍ0S0Y8p@ < 00aR09 P0SY0 0?R00S R|aUjh1nV @fP ?W0#S @P pD d00 S- p$P@<T@@$< @aP`0p`3/1Qa9 1Qa4 1Q/`.`+hpP`*~0Q` 0Z}렟JFS1S`hxxx8ic$pii`DMNTFSXBSFXreebsIsIeR0H|0@-P  ( @R00000 M  000$ 0$D,048<@(Ѝ0@-Kp p 0t0 b  耮@--p p D0Q40t0   0t0 b &, -LMRP@ r@9 Q6:1@ P0d T400 c!!08 00  8,|P4 0Y8`Pp X 0@ U@1 h PUp`00S 8q4(KP 0 t40 00PP08 00 040 Ĭ@-P`@p ppPP0 `0[tp <0Wt0T  Q R @|4@-T0Mp\`@Ѝ@ P@ЍH9 -LMR8 ? rp2 Q/:1p P0g W000 c!!`P4 0`  X 0@ U@1 PU`8 4{00@S 4(Kd s 0@0p4 0p L@PP@ 0`P4 00 l@-P`@p ppPP0 `0sp <0s0T  Q R @ȩ@-T0Mp\`@Ѝ@f P@EЍH90@-P L 0S \Q00S \S L 1S03S04S L0@4T 1T01S(0C 0L 2S 0 0L00S0C 0Lp@-@PM @`hP @ P, R 0R,S0=SS ,Sp p -LM0` 0 PS0S S SO \S K S SH \SF 0 S0S S S \S  S S \S 0 S0S S Sk \S g S Sd \Sb 0 S0S S S \S  S S \S 0 S0 04 :(K ` R R' \R 0   0S  R \000(0C00S` \00,0C0000 \00,0C0( 00  ` R R' \R 0   0S  R \000(0C00SPu \00,0C0000 \00,0C0( 00 D ` R R' \R 0   0S  R \000(0C00SpF \00,0C0000 \00,0C0( 00  ` R R' \R 0   0S  R \000(0C00S@ \00,0C0000 \00,0C0( 00 -PM Ѝ -L`P00 p cAA  ,} P0990РKG-`MIps  Ph  P000 0 S S#SS S S- S@) S( S& 0S300 000000 H 0@CT@ ۍ @ ~P  gP @p00W  0B S S  0S S+ S ' S& S$ 0S@"0  HPq0J@ S  0S:?C:0SH0HP000q 00@iT ^ 0 S S U S S S  S S 0S@ 00@FT > 0 S S  5 S S S S S 0S@00@"T P  0PI PKHH0@H 0SMڢp0 pDp003d01H 0@CT@pH0@H 0Sjڈp0 p)rp p p/1,Etp p/1( <Hp p p/1@-! pp @ p/1ڨ)D 0-0p p0/1̨8 < 0-0Pp p0 p/1@-$pp Յ@0 p/1"O-pMP `QQO 㟁p@ Ѝ41 p0 aR000w  Pp PP``{p@P Up z 0 R "0 D wp`0o0 @ 10 0 `((D $0w&& <,!44<S/Q1 S/A-`Pp1 0!1@P1pS p 01XPU@0 m01-M* Ѝ0@-0MP@S#0 S S  P ⑎P$d1 0 d!0S S S S 0S SSЍ0 P  oP00d10d1L P \P00 yP  sP0:0  jP070  aP070  XP070  OP090 ` FP090 @ =P060(4<LO-\ɟM Q!04M1 d1 00d1 9 BP!s/PP0C P 0C5,P!`QQQQQQQP` - `@ :`0_QSD@H 0 \RP%{* SPRt* Su S S0000 Q00@0S000 P> 0909J0  P ' 00#S;S | Pg0 S Sb R:  vPP  @bTe1.0ò@e1d1 02d1 G`0Sf Q`0D0HP &0004Ѝڍ S 0S S S0 S S SS@@ `P `0_AS S S 0S S SP00000  =P=0 S S8 Pv S S0 S S SSPPj `@ i_Q PP`0D@SH  \PR* S S0000 Q@0S000@  P 0 S SH  P0 S S| Qp$ Q Q QQ ;Q @T``;T tmP R 0   @T PS 00, PểPpS  R R S S@@0 S S S S ,⟃P XP000S j`  GPLPP A5<0@r 0 1Q  fP0 S S`" :ₑ,p@hq0PR @PQ;QPp Ppbp 0S;SP  l RH 0   P00,2P5  ,0 l1oc0@@DxP.P ` 001 210 $0, 4pl0S S S@hl00 $0, 0  0 ,0 05 00P:TDLܝ~`l4xPlG-b`0Z`P U @PTX`p` P :0@-P0M PRЍ00P @0@P:p@-@Q h0(l0`\P#Q ,Q Q l R0$ , 0   p\Ԋp@-T0@0l`DP@l R0$ , 00  plO-2M,  P ЍR0S'\ PX l2`@p\0 0. 0 0.   PPpW0p C}P!@0S:?C:0S^0S s   0S? 0@TPF 0 `S $p pS `!R d0   0  vP0  00 A d0P Ed 0SRk0 p  0Hs:\8;&4@-M@ dRp `R,0P,P R 0,0ЍLP 8 ,00,0(P `,0P,P:ip@-@M`p PP ,00,0Ѝ Pl0 , , X TRt 0 @P, P:ipfE-DqM@Pd@aT"A10  @,0A,0SB, 02 \ @#QQ Q#QЍ t 0 1P @T Hs  0 $P, ] g@:p fO-#@GM@@@ @@@@@ @$@(@,@LH3P@P 0990  P|  00 90`#SS@@ 뼂pfTN 2P P@,PU?  0S S S 0  R 0S 2j0pb@0S j0S0$ <0 0Z#Q  ds  0E@呾P! pQs  0E`~PL!  P 4P ,P 0#P 0P P X 00< 00Gߍ  | Z v:ThPpfx<0@-S 00@ @0S000& O-F`@giMPDpopj 00A SW00 WV 86Pi0 *R00p p0DY@L 0T& @P00D S Ta  R_ 00B S.R U%iP RD 0  7:T: Ѝ@yP 45 i@0PH 5R0P00<0  Y@8 TH0SH 00$h "00:P W WO t4h0  HH0 < 000Q.S W W PPH0 Y <  R 0  Q:QN0 @W@ P@ p0 0H R00Y <0q8 y3@R0#0 2S H0SH 00"yh "00ZY 0T< D0pSR@ eh R| 0  :Q .Q<0S0T.S6  hPS0 0p 0  0 H Z 0C@ 0@pP1)hP0@10@pp<0py~Xx1h0  v `  @@@0 T00C 0 0  0@ 0aH YH R< 000@ 000 $0, z00 $0, @@{l00 $0, LL H0o~~~d~},}|{`{H{zHz(zy@-`@M0PSp` 0 0Ѝ@ 0 PЍ:E-pR MP=1 ` V @ 0rPV# T@ @0P ZU n000 Ѝh ``rP@TUB n@-PP&Q- 0 R0 0#  c00#  c00#  c00#  c00#  c00# c0^3(0`00#  c00#  c 0@-{\0@@ SP \  \ 0 S T }\A 0\/\ 0S00S ^ :S0S0^ 0Q:S0^ :\A-鸀MP`p 0$Pp @0x P0\ P0@ P 0$PЍ܏ A-p @p  000 0R000\ 0SLPP!0S C R00 10 \ S.0/00O-M, 0 ?pPE 1PPr U  0R/S 0R B/SPEU0 S/R /00P Rt<@T)@T& 0S  .P[  0S 1SS  P0@ >pP0 qЍD\  Dha @PD  (!P0UP0/S\  0 R0D @0R0D  1 D00 @ Al[j0/Sfh`h@ X @T] 0`  40  PoD:&@-@MTP 0S @PЍk0 `p@P W  60 0@ 0^/ 0Wm4PhX -LM00 000 c@1d4 8 QQ6 4 Y28`  %0pS @0! Q 0  P0( S# 00@0ZG0@SQ 0` S 80S 04Sd0d  8 8 /0(K0/S004(#&tf\q`pP@ 4lT 0SQ0|"10  00`"10 0  B X 0 00 ( 0l9h/l -LM 0 4 gkp` #d 00@ ,l3PP PN0StcP|1(S1S2 SLcPqB0SpY0W1*P2 P0S*0S`V0S 0S@ 10 00 0 0 FS @`c dPVX P20S (Ka\\P ,2R(bP%0Si  00N00 c @ =  kV 0 c p =  kP 1d0Pa40S  0  0`B0@00 c 0 0S  1\ 0 404 0 S /k c 000 0P0U``S`PB 0S`P0Sp`P\a\X X0Q``PPmELFj9ii,x` -LM0 \ l X#X0 0 000 c@p  $#0  hß 0SE `p00I Rzu`Ÿ@0S0*`0S "10C B ?`g0YP\ \pŸ@0S0Y 1$c00ST 0@ 0T 0 SM P$ Q 0!10  0j0 KCliP 0 0RP?  (K0: S0 000 R  KUiP0 w5j0b0  q S 0S0Q0P0PP0U  hP AjP&:Pg9܏e -LM 0  K iP1"0PU 4K`K PU 1@1S1S1S1SiV(K @P\,0@ 0S S@   0 PP, 00 0T1 V? " 0"b0SV? 2!C 0 bX(* @ ` R R00 X;! V/0 @20S( R $;R 0R R0S (20,20S 0C0020!$2 0R 2V/0 @20S8Y> I2qC 0 0lR0 <`: 0 000@:op@ V01 b|1 `0100 01P1S@ Q9 p0L 0l0@S@1W :Q;`21C0VZ* Q0 00l0@9qop4)  0L0 B0c0l@0 00C0 b000   0Y 0 0c000 S` p8 !S200:0P170<2 @"2 /  `Yo{0S~ QS R" !R10  20bS2b!010 000S1070b S70b10  R\p0S 0SS<0S D0 Rd0S l0 R R 022` x   R 02 0S0\0 "?"#P!R00P1  x&000 "R00 22hP@&A!0SQ01T1% T0@S  2 5P0K1A4K!5 R> X R; 40 4@ @@ A01M (9 hPD%R @5`00SP  0\22 n0 R0 0l P1%0 00d20?np$40b S40b10 70 R0 00, R0 004 R0 008 R0 00< R0 00d R0 00| R0 00 R0 00L!R0 00`0Sh 1W Qc <P0d#0  P!0!h1 B5!Y?0M w  g R2a nL`m0S) 1"c P"^"Z"W"PP O2 R^0P0 U0PR |r pH`"=QH"5 P("* 0""1P01!  C ! !0&0 #0 `!!1g  mP!x!00082_d! XX T1zgPD @1ug@0 ,1pg 00 PV?0 0  P s9:xZQtd`9@bQso4opD:9\ o@o<8 8`ht8hP`dt -2L Mtbt2 h2d2dr 'PP 0D"1'0!B3 0SB 1"1q1@ p@0 /Sp_0S  00 R^P 0j^ l! 0X0 0SH1 (<1 (K00 1  &00 c x0PS  :0CS0 S0@P 0 PPA0SPg0(\\\ \0|fX099:& :܏D4hO- M` @pPQ* $Q V@ :Qp 1@ !0MP [8 0AsY/ 0 S V@ :S# 0SP00 Ѝ  0+P x0 @P P 0P <P$00܏9 8A-P@$ P @P  A*P Tp" aV v 0 P ! Br  P 0Aa0 R0@s0@s 0e9<hS(A-PqMp Q Ѝ1 0 P. d14 ^0 @P81& R 0:R 0R1`P 0 (R0`0:RR!00D0  0 R` RR @R@  0R S R :R R09T0܏@-RM0 000010Q ` 0 p$ 4zO 1mP 2 0S 0 !Ѝ ~2 x@ plAT f_ 0FP  e@T\0P 10SP f_ (0.P  Mx9O-MppPP08@T1d @T 1@P ߍ&W0#3  0S6  0 0?2/@PM X, P8` Xύ  00@@p`- l2pv 6@4l820 ύ@p @V@vP  %X R 40 `P10174ş0$4W) 0S& 5p`0 X@@ύ@O40$ @ @`p003v{ $0 U X( K @lATC fo L4TP 0ύ0$ pUp`( T 00SzO 33P 0ύ0$ p4`|||#|3cxht#h3c[( R 10S fo 3Py (@X@ύ@O00$ @ @p`cZ P, X Hύ,00@@p ,x@0P3 , HP8 `_ bX@@T 2 U0sQ ύ@O00@$ @ @`@h\?"RO  1 8+822 & 8!02@RP`;  `P6 l 0@P- 10!10!x1n谟@0,0  0 1P @T 0 0 Rm G0Z0x0m  `0f 9:\؏xhH܏Fx0@-P@Q1 0A0 S$0 @0 S+ 00A S@1   0B00A S00@ S1  0B00@ S ^ l000@ S QQ`00`00@-$@0@s0h00&&O-%$M0`\u0S2 x@@* 5y< 0%S J?àqR0g 0 40iX@  0?àqR0g 040X}Pa @J[00$ЍT p@ PU2Ah000C0 4QJ?@qR"0g!B0 0b S  3 : 0?@qR0g00[ ;P D Y )P@ 0܃"!B  00U*000Sx 3aZJ21C 04 X0g00 P@ Z , 0JX@D PP qR0g@0  0Z X PPP X@T 2 P  ZpB 0R00SV x Rl2 R 0R:T"0 @0A 0@0@02 P0U? P1@@| 5 Pv sTD21C0 [0g0pP@ TD  0D[ PEBp@0zP @Rq0g0 P T[0gPQQ [ R 0 Q @ T P} p PVqRS\i 0\0 QkpPqR@a:&&&8P\l9& p@-L1S  0PxQ`A@! |101C1!p00Sp00! !x1p  0`t@-0MSP @ 00S PЍ $0R00S 00SS! 0U#`V* \? 0p0p92 @TP 0ST  S 0U 0P`V\ 0 08  8R 00SP0P P P s 0_`O-,M 0\00`h0T$0XPdp 1`PW`?  0@T@ $0 1 1@2 E@x1S 408 QD |1!2:"0 13 12S0 00S 0SP P % P ,ЍQ 0#2S S1 R P 0S0 0P   0S1 0 & p5 xL1P @0 P  P xL11S !1@@ 0*00 ! bB! P P$  \ 2Q  2\  2Q 0 2\ 20"0"\" #:9 \ -LMPx |0 Z Z 20PPh*P8pK000  X| t \ |@t0`K0x03?7\ 0  pP80S R4@p  000S0S0#p0 [ 4@10S 1X)01 L90S8040(KP= xQx PP0S5 0~ 8( 8P0 8D H0 8T L @0 < X XK@p XG p W@00 c @XWpGX G pR W`(0  D8 @8QPPP 8XK |\@0`Kt \ t0XK  CP X0Sy T0xSu 0x80 4 @p|0 0St 8 t t00t0 1S/'7{^0S 0#2S X  ]xV 0S6 6Q4x @0Sx6Ɵ 6p R 0p 0S T| 0 $ x0Tn 2kxQaV 0S T0_T0\  RU`P  P` 0TM10 TH ` Q 000 l h l5S d3/x\%0100 S TS 0 S TSR H2l S P5S 3/\ U04U Rx0 1|0  x |0 Y4@P|$P4]40xS0 x@8 4@ x0Sxc`Pß  \ß0S3 3Q``T P L X X K@P X0E PU@00 c PX@XD @T0h#S` juUJ>@0 R Bp3S 3/x1VS SQ RN T  RI T0H2lSgL2hScPbL2h S]"x10S 0P2R2x` 1R<*x0`! 10@x0!01 @ 0PS1 x 0S1 x0 0\ %xQ U7 R`  0T `0P 10 TSp0, p`P `0S`P xQ `0 @ xqPa 2P02`\* 10 0Tp ` P` :\ 4Gx9]0DO- MP`4PpZ %Np @ ]  1 0 n01P!A lQ0 R`  0S  0 W/`     H2LB0@UPPl1SV W? W? S 0 ! 0W?10@T Ѝ-/T`P @PP \P0`T00"S `a 3P`  0p/SP00a0P`/S/0099,+@T M"p n< $20@0P 0 Y4@-`0@<@"  a P` aP0S0 0<9) @-P M@`Tp 00`0 Rt0% # % Ѝ`p0S  "0@xaP0@((( (0[^&&&@2\@-@S 80Q4 8210  $"k$2(" c@A  0l[dlp@-0,B PT`@Gh0( 0S 400!101p 00p88xd -L|Mp  0 S: ? x0Sz 4 P|0  SQX d 0RH0 D0 @0 80 0hH0  D p0S 0SG @KP P 0S0p0 O80 0Rt0 0  1S0!1.`W Z0ST p0^x0 F0t#4"x 00 PpU U 0#2@5T0 0|@ 0E| SnPonnnnnnnnnnnnnn@o$on0.210P p001Ѝ88/40SP @ 088p@-0S0p0 0`P@P 0S00 ] 0$P0eS:\ P@0eS*01 0 R 0P4(O $0 PPp8888-8Q Gp0 \p0Q*D0 Q01:00b R0!\*88A-P0pS`E @0 Rp 0 S@W0I. ``A80@-40@ MPPP@Ѝ08O-P MZ 1吱PpP3U?* 0SI010 `p8 !8210PQ)0`S 2:p@T 04Y1P 82S)("$2R*: 82 10 $"O$2(" c&PQ0P*ZLLL L0DO Ѝ8(4 (0;O,( 06O88l 8p@-p0p`I. 0`0@PP@ 0@@c0 JD_@P p8x-PM PЍ^@-M P* XUpP00 p0Sp& 01 0[S! /S@P@0/S ppW 0R B/S0G0P% W@$  G00ڍⰀPP p0P  @ P@P0P/S 00@( y0 0N9Ĩ@-l0 d0\@P0a TP8 000$0{F0 P @؏9p -L Tt 2, 0S) 0!%D 0K< % K8 14 ,KTK@@ T` Lp H PP @0P%@6 0S1S x3/D K h1 X1H1S 03/ 4100/,1NDP 1  @ 0S  0N0S 3/0`,0p P 00 cP %0[S0, ]  00 cP0,0 0x9<h <@8op@-PEDTp`@T 1R10 P p0 R  B10  RpP 00Pp0wp99A-`P\ p p\1!p Q0X!10` @T2 0T:\ \1101 0`\00pr@P# !!0 pFE@4S+0` 000 0XP @!0` @0  0099 -L$M$ 2pP l6P`V @1U :1U*1{P @T@t  @T=W@  0@P` 1\AT)ş  0`\ \1!pQ @\@ @0 SP @@ 0S 10 T @ 10 pT`\ < p3I p\%\1Q! 0 S0S@  W/S@AS@ @1S 1RA1n* 00!W?0`p\<0S #00S0P 0 =#  P  2023 3@?(K(2S 1\` < @S %`t((K/$3=L0S`7  34LV@@`@/2 PRPf@t /:P`!F=1 \n/Q0  S040 %P A 0  R̡ /401s0040 011! !1K 8 &pP8 VJ QU; u !0P0!80C 00 c@  0^PD @1/<A/1K0 @  1-  0SK Q/0K0 0 R0@s0@sx@t <0K T `098:L9d9hHp@-@ PdU`&:Q  P0 Pd/0 ! T00S%*0LS B@ 0pS 9 05K10S 82 S X0  !00 \ pp$N 0K88\p8| -LDM1C\1 R : @(K0S 1"00\ X0 X` 00! c  ` cP bh*Q00p "  QpX  Xb0AS10SK 000!0CR2 0S "r R5X30S00 20C^ࠡ0SQ 0S 0S00" BR࠱0 S 10"r RX 8xJ 8sJ1S20S  bX0\ 0 u!W p\0 Rd d 0L P H D0 8 #!0S2@@1@01H 80D H S8 5#03P %D 5P0 58Q8 8dqPh80S 10S\1S| 0@40 \C  0Y_0SH S W/C0P}2s@6 H0S 0# 1P@053/ TT0S!  003/!!001ZL   LPL 0 !l1S 2s0l1D08S0!D0 Z nZTP@f 0  40S 1040  \ \ 0s!R 0S 1S 0W/@4 \1`oV/5Ien?P `1p Yp USZp`mT R $00S0 $0Y<00@0 0u<0S``!0 jP \ f  P R d80@ 0WH0S+ X\ @ 1 1@   A1@ PH0\  P @1@Q P A4SaDX1p< `T  PR0S(2Sv`N RX 0 0 00X00C0 pR00p 02 @RTH 0@SPH  1H 1H 1H\   1 `H RL0SA0S 0S 1@T R  B10 m y4A0$ 1Q 108 P0 42S S  (2<0Q< T m |0Y<4"(2<  T `,| (0NH(2 cT V:&9p88<(99888@-2@P \0S T3/ H0S8@1((( (0H 0xlp-LA%@/MM $ LA0\Ѝ`/p8pM M  H/@H 0Р q\ލ/-0?8 -L{MO@?l2  " \0 0 pl0  WP A x!g?0 PP \@ K@P1s  >xAP?0@!R P R4 5X *\  2@T02 2@TV P0 L R ! T2B00@ S! 1  0 B00@ S! $P< 0A1 A 1 \n L0@P.S񟗢$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$  '\*\! @   I\1;1 '\*\  @*\  I\ '\Q! ! P0@ \ ! A!00 0@ \\ ! R-*01  V  40   q:x!>0  R*01   40  T`@sTST [T @uT V[TcT7 CTnT4 $*$T> 0`0 R8 *   40  p9;>0 R 40   9,>0q` 10C 1 P%0DR SS}4444444444444444444444444444444444444444<444444d444444L4(4444@440444 R*P`  80tQ!QA R MMAAxA580@0>08x014 0J< At R *  !!4K0 W   !4K0 gW  U P0 000 ?K!` ! y ᘰp |MM11L1 A  \̠3 10 c11P 1  A0-S+S R*  ! 0! ! R*  0 p1 t1 !T K"1!  Q!0S TK ]?K$p1s)h?xA70@X/7 T0P0K ]?Kp P !1 B0R! 1 |i R*01  RY*   K R*  0 t0 x0 !40  1xPK0KTK 0p| >xC70.?7 T0P0 R2*01   KPw T !!  1 Q0S \\  p5 R*01  AA \1 0 000 20 e!R0 000 |  ᵩPD`VY 0S@P 0P 00@Qq@ $!  1S0 000 ! Q ! R+! 1P \ R 10  q;x!60 \5 K!`,!  1S0 000 ! Q d!P 1S R 10 d  `"! 0 !R0 000 ! P dP K !Ra R^ 1 0 d  q$:x!E60 :xA?60@9x960!Rf0 000  KP,\0 000  1A00A 4K Z40!S 1S0 000 1S0A40AS \ ` T 1s!2xAp40@"!r=2xAg40@1s8@2x\40/0iSz!q8@xl2O4x0/0lSl1s@2xAB40P@PhA  !R1S0C1 |1x,40 1A0 S<31 10 cT1A  ᶬp w ᰬp \140x ᣬp A4K s40ST !R0 000 1S1bBM11 1  Ql 1AS7 |0x30/ 4K!B40S1#,̷4Գ$\0ȫpĨH4@8 Dȡ0<$D,!AR ! A 0 @ Z !@Q1A s0xA30@ RL *01  A@A V A!   Q0 S AT@TA  | R*A0@1 A  40   1!0C 1 V! ` 7 !1`Q,/1x0031 K R(*  PA@DTA >| R*0P1  !A0S V!  !A0 S@!@^PW0T1 eA00P  CF,320x AT= VQ `X! ` !1`Q 0PA `  Q ?!- 1S~0 000  KP`0 RU *01  TA@A =!l!@ P  =r6 R*   V Q!0S1SAD @P 101 A !r R;*   AQ `85xA]20@VT !1`SIL R *  0P@X0 T0 L\ :p Rb*0@1  ! 0S' VxK X0KxKpA !   !1Q0S PyP !P1Q P!  @DդU \` VA `{! ` !1`AS TP`  A c(710P0X U:HHH'H791!SL`3P !PQ a 7x!10  P R*01  0 ! W\MM11 1  1!Q0 s 8xA10@ R*   Q0 000 [AT0 000 [{ p 8s10x R+ *01   E Q310! c1R A  -A H)0 O11 00d9I1x0 R*01  A@A S1S40 000 ! P!R0 000 ! ũp :10x Q 8Q0 000 ! PjnP100C8 80 8 080 ៩p :00x a M11  1 1S100C8 80 8 080 ! 1S100C8 80 8 080 ! 1BS 100C8@ 80 8 080 \ 100C8 80 8 080 ! ZM11 1 P100C8 80 8 080 ! Q70 000 ! P' !Rf0 000 `  A"T100C8 80 8 080 MM11,1 ! p !  B ! ,CΆP !PQ 101 0 0?R00S 0S W q x01  pG 0? R00S 0S !W0 1 RPA: Ῠp >00Q x 0>x00! l R*1@  80aQ^1!SA R 1MM 11̠ 1 !QG p>xA/0@??x/0 RW*  ! 0! ! R*@ A  80 nQAT MMAA!,A ! A1P@! Q310 c1R A  oMM111 <1 @P !1 ! A Q0 000 `?xt/0l p e 101 ?xe/0\ 100C8 80 8 080 1A0 S<31 10 cT1A   p "  AT100C8 80 8 080 wA@ TL310 c1\A A^  Y1S100C8 80 8 080 ! 1BS 100C8@ 80 8 080 !2R80 100C80 8 080 ! \ 100C8 80 8 080 ! "1BS100C8@ 80 8 080  P 310 c11Q 1 9  5 R*@  80nQ1Q! B! S MM 11 1  !1R pp\ 100C8 80 8 080 !2R80 100C80 8 080 ! p ,H7I-0x & p ] 101 ۥp 65-0x  Хp O  ǥp > P 1BS 100C8@ 80 8 080 H 0]/H 0fA Rp*01  A@A ᠥp 6,0x 6x,0 !R!Q R㨁 դ Qڨ 夁 101 CPQ PQ + up @!2RB80 100C80 8 080 E05,x0< Zp d  # P !PQ  R<*  )PQMM11,1 ! 1A01 000NB+ %p 04x0|, q q p 3o,0x 00@ 1 A xPK!t`]K `A@H KH@ D@ Mpp< \ @T f000 cAA8 5001 K@A0@(S1 A l !ቷP PQ P2,0x A T1 A00P a `hT2,0x L ៤p  ᙤp 2+0x Ꭴp K   YC1+0x 1+0`x U tp 1 @A U1Sg }!1 ! (P PQ VA .00P a `CQ/ Kp 0+0/x F!QA R MMAAjl.04 % 0X0  0t 0\!R} tp$0S t 400P D L H0 0 R Pp R0$@P+@ 8KPK4K- K=4@`T|<1`0j W RW P01ԯ`P t@Q  {ta0S 0S  R | <%0 0r3SQ<0Px  10S x  \0◯P  \ 10 \10`0 \ X0 \1! X 1`01 RX ;  n\ R ^0\  P \1!1\@0 01 0S7 @0@S1Q0p!` >`PJ    0Sࠑ 1`1000S @@0S0St\1!1P`01010 \ ᷺\1 QRp  1Sp W*1`!RU  0S0pS` \@@x 0R x|\(KPl 80S0 ᘵh taV v Ꮅ8t h0\ !l B2#00 c0 !0SX8  P1 s 3 Q Ry (80S101Mpp t$0Sq0Sn0SkM  01\@0 0\ 1D00 c 8@P900 c  -0[8 S 4V4P |` | rrf0$`=P@ 0s 6 PK8K4K- K6T4@`Tp0Mp00W<00<01<1` ;p< 1@0 01< R 0 0< R000<  <00< 0S \0< \ 0p p R   A j! p0S` R3 0Pp 0 S < R 0 0< R000<  <00< 0S < 0 00 Rt0@s\1S $4+  \ MD4 PK8K4K- K44P] -0[S M ! 40SyX 1 `10C`1㛼Pd , 30S0 9Bt` AT$ t 8X3 `0\ !d B2#00 ct 0P0s 2 _ h[0 R0@st0  2"2+ 2y0  2s|  840l  X2fT,P",2* 2\42p0W\ X\1AW, 1S 0S&0S-`V*RPP:U 0!1U`01aԬP P1 }\Q<8!1* $1  0t 0S0   0*p0|00 c M8@Pq6t0 0Sx0  Rrrtqp:܏9Zx(t<&hX?9+\(/O-1p10PMU@|08 04 #42``0S; 0=P3 !$ 0p92@ R( "4J@S81`p  `0S0S \0 P0 RP@ 0 0sЍ@\\ X0) 0P0S 0p049<\lE-|08 p0#44 2M` 0S7 00*Q- "$ 0p92@ R" !4J^@S. 21p`P p*0SP \ 0 h0 RЍ @LLP H0)0S0 p049<\E-@Mp Ѝ01\' PP 0 $P 0 0 3/Q 0#aP @  @T0S 1\0 yP:\G-apPP@*UT 0#a`aV1@CP1P  0U@D0  0@P  @T`aV00 0S0 2::\O-M@\ 0 ZT |3 10 0 ZI ` V2s  0Z P 0Sq*  P01 0 Uf 0PV R 1  p1S R V5V02  R!R10  0 0R0 ZЍQ:02V Ae !⛴0Sp 0 @叴@0Ae !ℴ Qp 0 @x@pP / 0J( -LM8 0 4 hP `X23/4T"0Q8 00!RS00 c0  00 c0 S0 0 41 R_ @ R 0SQe!1B01 @RTJ4|08  \1S H3/Y+ q1 0Q1+ 1 0Q 0#a 1P@@053/TT0S 0 03/10C X184@$Ap8 4 ~(KT0S`` \0'T0SL0 8 4  0'x9:\ -L(Mdß4@P`p0S| Qt 0 @R F0S @0S?0S 0ïP@$K 0S 0S 2<0 2@` 8 40 D Q@PD`KL@TP00 cPDô@D@⿴T@D0S2  0 1K1 K 0!1, (0 0 P@0`KP U@00 cP0呴@@⍴ T @Dhhq d1 '0S T41, (0 0 @P0`K@ TP00 cP0j@D@f T @D 0S0 0 #Q0<0 0@` 8 40 D ʯP@D`KůPU@00 cPD<@@8T@Dw:\\xX -LLM`4\ P` T QP ]  0S0X0 0"10#pPU0 PU- P `0S0@@0S3 0 \0 0 88X1X0R0X0  0S `1S @`1@S \1QeP \1PU 2=&TX P R  0 88X1RXX(K@\PpDŸ  0tA T0!S-  0P p1@    0 @p1     0 p090 p1 "p0 0 0 0S 0SPPQ  00 @P p)("(0p 02p P0SX 1G g9K 09 K墂 04 00 8 ᬮP@8pK秮P U@00 cP8@@ T0S0  0 9\ `8 @-PMp`P @P1 0 @PTЍ P00@-@ PM1 P Ѝ0 -L4 K 04P S  0(KP0U# 0 0l\>4 K P04@SJ~@ 14 K ``0U 1W:1W: 1b0 40KH @0 P TP L 圔0TK8K<K- K<` P0S 0p<@TT0 00 c ⒲8@pᶭ00 c ⇲-0[@S <唠 0!9@- M0E Ѝp@-MP\  `P @%  @^ 2\@  2^ @  2\@0 2^ @ 20"0"^"L# 0 @ Ѝp@- @ Z0 @E$L0@-@P@O00@;K@- @ E0 @K0@-@P@:00@KO-M04`@p P 00A SV 0S @!00PE00CU@ P R+00 R0 0S 0S0 R@(0 R QA 1R00FЍ1XL 0R0 \ 0@S 0Q 0 0 0 100  0P 0 0S0P00! ( 00 R00 0L P0R0 \ 0ES 0Q 0 00  PU 0 0S0 0ʚ;E-~qM@`p P$} a\0!^ !00& 50C\* 0`PLJ~@65 X  050C 00t Tڌ0ZЍ@ ЍE`0P065V~@  0J0@508HO-M,00R0P0T0$,L4 P@ 0*-T +TP@8 \ 0 0 S 0S0 R0/S00D So80!iRE nR] 0P 0 Ѝ9S0Tz , 8 0<0Pp3Y 0Tpp@0T 0D0 S1<`Q`V 00Si \ 0 S Zp0V0U0S`0 S<P Y TPU:ZPP\ 0 S 0S0 RL  a0LS00R0u0S P00B S`<0S !<0P0eR0S Z@0V0SA0QI0S Z00Y0S ^AHH0\@YF U' @^`@ ^@V 0^ 0S0 R<0P !bL 0 e<0S( R(H nQHa0'Sl,~l0SӐD 0ՄڸLPl 0A ^pڬkppp␰P\; 0@ZIpPp\0ppG\p^P`  0%@CT \  0 !\ p8I0S0 R< RUL0 00B S1a0C0S1a0C0S@0D <^p\^ < 0P0eR0S$ @-Qb +Q0X0X00A S[q X^0j 11!0000CP00A SX0Sn Z@P8Y,0 81xSP@<T{fV[ , 4 0#60#0SL0P[00I?Y00SH00CH0 [00@ S00 X <QeV 00Sm P T0L0 R U> 008\1'0\8^10P LV UW W#@!H% P!* 0 00C SR@PH R!p➮pG 100 RZ:4R00238 bbQDKD0S0C@ba \1D PdÜ0 G2$%Q 0fSڐ0S1S ! 00l DQ RN8 !HD%0nA0l U b[0`0ո0p @c`pp␐`@ 0 B1@ !%T`P  @0Q @$ <  @ BG 0@0CP @Np@P/ @0L 4LP A 0P R:4R0023ğ @bT@ 0ppQG0 LGP 10p0p@DP P% @ 0A1 0b p00P`PGPp1 00 żp@ p¼pRVW10C 0 R0@ h @0D1$0 0\P @0Ҹp(ՓYpO &  t   x 0'x0 )8HR@K*RK@@b [ P  8#88R0PE*RPE00b x@P('( "Ȝ!\N2 h @^0 f00\RpGP*( 0pJ$ 0@00P p @0cFpG400P0$0 @  B0R0!D\ W Wa*W 0073 b 0aaSL 0a7S$h 0P@0 ?Y00S $@A 0?R00S` h0OcN8 0@-XP'0j=гVUUU$+(`(4(,4`0  0   0Q 00A S, 8 1NW C0@@`0SH0P!0IS SPLP @0  L@00A S ,0@8 @1W C\0L0l2S038 @P@ f B0GP0P @0 <0P@@8 1R0k B-P0(S 0^R 00R 00I,0P8 00B S1a0C0S_R )R) B,090`Sp 0@02;4D r D ps0p 0C0nD00sh0$00lYD@A/-000bS` Sg 0cNEp0gS 01 0gS8 0|8 0pHlQ aQDp"ڷ4W00,8<0pPSt`0p吰d0D\@iW & ~  x'x +8HR@I*RI@@b i   8#8(P H*PH ` H%$(8  "Ȝ"  Pf00\00S 0\V@D0 SpD\*T7 TW*T 00430 b 0aaSB 0a4SdP`0W0SPP[PdN`8 0PpDp D@{: e0@p@ NnDqd  d0mDd0 c04RPUEe@ aQD@Rڻ4T00ppP*'C @HS`@`@*S`F@@c0 P0R0C*R0CD@b\hV V@*V 0063x b 0aaS aQD`dPDp PD`P N`DpaW  0C0 g6RP` gT @N8 0@#4V000 R 00 Ch0 l7RP\D0@S @gD2ZPhPմP D  bRh ڴ h0CpDW 01!01P0 Q 01 RQFPu X0*; S"00| 8\1000C S0Q. 0 @Zg 0CCp0gS0!C # 01 0gS,T00C0S( P 0S 100 2TPi@0p!̩P R 0S\ 0SWP0 R0F`Nꐰ VK0pd0Pp`0T V 0S0SP0 R0Gp@ZG8 <^NhNp 0g6SP g0!yp0gS 01 0gSʠ8Q1\D^ N pdոDaQdڴ d0B됰D p D -s "008 l=R-0"  8 a>R.0"  p0 C0 2:1:1/$%+;4/  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# 00Œ /G-PPMp`% 0 SM LQ GFED,;0 48`Q p0S Ѝ00`0 P $(< L` 0P@000c0 `48C.`0 `-PM p P @P PP 0P }.PЍP u.ЍS ЍIЍH E-P4Mp *P  4Ѝ 0   HPP W #@T    0FP0S000 2 00000+   0P 0 0`CU*@ ,0@P~ (0@Pt $0, 0P V 5P1:(00V: U:$ R 0P @ 0  0 @  0z   0 e@-0QM`@Q 0!Rp 0p1aS 3/1@@pP @pU @凕ᅕTP PP W @zxTPЍ8Ƞ|0@-42MS (2|0"2S 2q0!1S 1f0!1S 1[0!1S 1P0!1S 1E0|!p1S h1:0\!uP1S H1/0P@XP X@Ѝ0@%p  4 D |\̷8Ը|A-䀟`V p尔PUP1@0S 3/P⢔ UបW`x @ Td0T  @T PᅔU@ 0 $ $p@-`@T P00P iged0@T\0\ P [L@LPH90P0p00NPp8ԬȬ\ 0@-D0MPU P @64TPЍ0$@-0``MP '<0S pPp ZK<0S 80p@ P0@s8P T0S @3/P 0S Ѝ@괯@-H@H0 P hd0`P@-8@P 00ғP@̓00X\\-D D0MP 0廓, ,0P 0Ѝ䲓Ѝl@- @0S:?C:0Sp0x @P偤0S U㰀@ጓTPp%0 p8<89D@- MpW1 00`V PU P G@aTP@[T`PU@QTP 0@s8G@FTPЍ@?Ѝ%\ @-@P$G00% p/00*% p/00"`9 p/00l9 p/00x90@-0P MQ @0Sd0PU  00PT 0@ST PUЍ0: :90@-PMP P PT  @0/SђPTЍ0-M[L0P @<0P ,0P ЍЍ :\ $: &z@- MQ`+ p P0S @T 0S cF4/  pQ

~/.bashrcbash%s: option requires an argument%s: invalid option%c%c: invalid option??host??TERMemacsEMACStermdumbPS1PS2/etc/bash.bashrc/etc/profile~/.profile~/.bash_profile~/.bash_login/sdcard/bash_profiledebugdebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfileverboseversiontimed out waiting for input: auto-logout PROMPT_COMMANDPWDeterm/%s TMOUTreader_loopstdin; ;PIPESTATUSreadline stdin ; syntax error near unexpected token `%s' ;|&syntax error near `%s'syntax error: unexpected end of filesyntax error%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEttyunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'esacevalletunexpected token `%s', expected `)'expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operator=~-nunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandparser stack overflowUse "%s" to leave the shell. exit"$@"parse errorifthenelseelifcaseforselectwhileuntildodonefunction{[[]]-p&&||>><<<&>&;;<<-<<<&>>|EOF<|&newline {();&| #  7  )8HY\foqu|4=hsxr4ep4*=)4hh4"I)4hhhhhh) $ Jt Z_hhhhh !1<,*451+0/2.3  !"#$%&'()-# 9 , 78:,-=,11,24 @,a+,-4,42ef2i,.2,,5v224z{.j,pghh2xy,,}~22,,221+1.+45+,-*+5+,- !"#$&'()/0 !"#$&'()335/05  *+,%33%3 333 !"#$3&'(),-/0!24 3  !"#$&'()+,-/024  !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0;<`?0z/OSPT3\]uw7|bc:qxQUqo=A >qklmqByq8M9qqNiq00RVqq%& WqXYqZ`[p00v{ef}klmghef00~klm^  !"'     # $(*-)._+ j@ klm q   q CDEFGHIJKLyyy$%Yyy&)+,/930.54678{iyyyy !"$*'-tuyy|}ywvxyzhjsyyyyyyyZy  # XT(yyyyyyyyyyyRQ~yyUlmk^yyyyDEyyyy12SOWnopqrNd_Lf:y;FyGPVyyyyeMy<=yyBCHI[yg`ayyyyy]bc@A\>?JK  66667788888888888888888888888888888999::;;<<<<===========>>>>>>>>????@@@@@@AAABBBCCDEEEFGHIIIJJKKKKLLMMNOOPPPQQQQQQRRSSSTTUUUVVVVVWWWWWWXXYY"g@h^TI, a!"#$%&'()*+,-45rsdn6.t12:~OLDPWD/dev/tty`%s': not a valid identifier%s%sgetcwd: cannot access parent directoriesclean_simple_commandmake_redirection: redirection instruction `%d' out of rangemake_here_document: bad instruction type %dsyntax error: arithmetic expression requiredsyntax error: `;' unexpectedsyntax error: `((%s))'%ucprintf: `%c': invalid format character! ( ) && || [[ ]]case %s in select %s in for %s in > %s< %s>> %s<<%s%s <<< %s%d<&%d%d>&%d%d<&%s%d>&%s%d<&%d-%d>&%d-%d<&%s-%d>&%s-%d>&->&%s<> %s>|%stime -p do for (( | if then else %cprint_command: bad connector `%d'function %s () { } { print_command() do PS4(( )) '' %s ]] case %s in ''%s%s=(%s) %s=%s dispose_commandcannot duplicate fd %d to fd %d%s: %s: bad interpreter/dev/nullcannot redirect standard input from /dev/null: %seval_builtinbuiltin_envreturn_temp_envexecute_cond_nodeexecute-commandPS3#? LINESCOLUMNS%*d%s%spipe-file-descriptorsexecute_connectionloop_redirections%s: readonly functionexecute_commandfunction_callingsimple-commandsaved redirectssaved_redirects%s: restricted: cannot specify `/' in command names%s: command not foundexecute-shell-functionreal %2R user %2U sys %2S real %3lR user %3lU sys %3lSTIMEFORMAT: `%c': invalid format characterd pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextIFSpop_scope: head of shell_variables not a temporary environment scopeBASH_ARGVBASH_ARGCall_local_variables: no function context at current scope) {_=make_local_variable: no function context at current scopeOPTERRignorespaceignoredupsignorebotherasedupsHISTFILE%s=PPIDshell-initSHLVLshell level (%d) too high, resetting to 1() {error importing function definition for `%s'/usr/gnu/bin:/usr/local/bin:/bin:/usr/bin:.+ HOSTTYPEarmOSTYPElinux-gnueabiMACHTYPEHOSTNAME60060MAILCHECKOPTINDBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRING~/.sh_history~/.bash_historyIGNOREEOFignoreeofHISTCONTROLHISTIGNOREUIDEUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMLINENOHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSGLOBIGNOREHISTFILESIZEHISTSIZEHISTTIMEFORMATHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistcharslast command: %s (null)Aborting...%s: %s: %d%s: line %s: %s:%s%d: %s: warning: %s: readonly variable%s: unbound variablebash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jump(8%s%s%s: %s (error token is "%s")expression recursion level exceededsyntax error in expressionrecursion stack underflowinvalid arithmetic basevalue too great for base*/%+-&^|syntax error: operand expectedsyntax error: invalid arithmetic operatoridentifier expected after pre-increment or pre-decrementmissing `)'exponent less than 0division by 0`:' expected for conditional expressionattempted assignment to non-variablebug: bad expassign token%ld wait_for(%ld): %sSignal %d (core dumped)waitwait: pid %ld is not a child of this shellforkcannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1command substitution%s: cannot assign list to array member$(bad substitution: no closing `%s' in %s$[[#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution??$%s: cannot assign in this way<(>(cannot make pipe for process substitution/dev/fd/cannot make child for process substitutioncannot duplicate named pipe %s as fd %dprocess substitutionbad substitution: no closing "`" in %sno match: %s%s: parameter null or not setYou have mail in $_You have new mail in $_The mail in %s has been read unknowninterrupt trapreturn traperror trapdebug trapexit trapinvalid signal numberrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselftraptrap_handler: bad signal %dSIGcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %d%s: integer expression expectedargument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments%s.%d(%d)-%s%s.%d(%d)GNU bash, version %s (%s) Copyright (C) 2005 Free Software Foundation, Inc. 3.2release@(#)Bash version 3.2.0(7) release GNU ;|&( ;|&()'()'%s[%s: %s[%s]: %s%s: cannot assign to non-numeric indexarray assignbad array subscript,%s%s%s;&()|<>500%s: cannot create: %s%s: first non-whitespace character is not `"'no closing `%c' in %s%s: missing colon separatorbash_execute_unix_command: cannot find keymap for commandbash_execute_unix_commandcompletion-ignore-case;|&{(`$include hostname_completion_file/etc/hostssymlink-hook()<>;&| %s %dC-xC-efc -e "${VISUAL:-${EDITOR:-emacs}}"fc -e vifc -e "${VISUAL:-${EDITOR:-vi}}" "' $@$Bashshell-expand-linehistory-expand-linemagic-spacehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{comment-begin#FIGNORE "'@><=;|&(: "'><=;|&(:$POSIX"" #: %s:%d msgid %s%s msgstr "" /usr/local/share/localeredirection error: cannot duplicate fdsh-thdfile descriptor out of range%s: ambiguous redirect%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here document: %s/dev/tcp/*/*/dev/udp/*/*COMP_LINECOMP_POINTCOMP_WORDSCOMP_CWORDcompletion: function `%s' not foundCOMPREPLYprogcomp_insert: %s: NULL COMPSPECxrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: cannot allocate %lu bytes (%lu bytes allocated)EXITSIGCLDSIGPWRSIGPOLLSIGSTKFLTSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGURGSIGSTOPSIGTSTPSIGCONTSIGCHLDSIGTTINSIGTTOUSIGIOSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGUSR1SIGUSR2SIGJUNK(%d)DEBUGERRRETURNalias [-p] [name[=value] ... ]unaliasunalias [-a] name [name ...]bindbind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]breakbreak [n]continuecontinue [n]builtin [shell-builtin [arg ...]]callercaller [EXPR]cdcd [-L|-P] [dir]pwdpwd [-LP]truefalsecommand [-pVv] command [arg ...]declaredeclare [-afFirtx] [-p] [name[=value] ...]typesettypeset [-afFirtx] [-p] name[=value] ...locallocal name[=value] ...echo [-neE] [arg ...]enableenable [-pnds] [-a] [-f filename] [name ...]eval [arg ...]getoptsgetopts optstring name [arg]execexec [-cl] [-a name] file [redirection ...]exit [n]fcfc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]hashhash [-lr] [-p pathname] [-dt] [name ...]help [-s] [pattern ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]killkill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]let arg [arg ...]readread [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]returnreturn [n]set [--abefhkmnptuvxBCHP] [-o option] [arg ...]unsetunset [-f] [-v] [name ...]exportexport [-nf] [name[=value] ...] or export -preadonlyreadonly [-af] [name[=value] ...] or readonly -pshiftshift [n]sourcesource filename [arguments]. filename [arguments]testtest [expr][ arg... ]timestrap [-lp] [arg signal_spec ...]type [-afptP] name [name ...]ulimitulimit [-SHacdfilmnpqstuvx] [limit]umaskumask [-p] [-S] [mode]wait [n]for NAME [in WORDS ... ;] do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donetime [-p] PIPELINEcase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }{ ... }%JOB_SPEC [&](( ... ))(( expression ))[[ ... ]][[ expression ]]variablesvariables - Some variable names and meaningspushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirs [-clpv] [+N] [-N]shoptshopt [-pqsu] [-o long-option] optname [optname...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgencompgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]`alias' with no arguments or with the -p option prints the list of aliases in the form alias NAME=VALUE on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Alias returns true unless a NAME is given for which no alias has been defined.Remove NAMEs from the list of defined aliases. If the -a option is given, then remove all alias definitions.Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: bind '"\C-x\C-r": re-read-init-file'. bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Exit from within a FOR, WHILE or UNTIL loop. If N is specified, break N levels.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resume at the N-th enclosing loop.Run a shell builtin. This is useful when you wish to rename a shell builtin to be a function, but need the functionality of the builtin within the function itself.Returns the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0.Change the current directory to DIR. The variable $HOME is the default DIR. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory, i.e. `.'. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, then try the word as a variable name. If that variable has a value, then cd to the value of that variable. The -P option says to use the physical directory structure instead of following symbolic links; the -L option forces symbolic links to be followed.Print the current working directory. With the -P option, pwd prints the physical directory, without any symbolic links; the -L option makes pwd follow symbolic links.No effect; the command does nothing. A zero exit code is returned.Return a successful result.Return an unsuccessful result.Runs COMMAND with ARGS ignoring shell functions. If you have a shell function called `ls', and you wish to call the command `ls', you can say "command ls". If the -p option is given, a default value is used for PATH that is guaranteed to find all of the standard utilities. If the -V or -v option is given, a string is printed describing COMMAND. The -V option produces a more verbose description.Declare variables and/or give them attributes. If no NAMEs are given, then display the values of variables instead. The -p option will display the attributes and values of each NAME. The flags are: -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names (and line number and source file name if debugging) without definitions -i to make NAMEs have the `integer' attribute -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -x to make NAMEs export Variables with the integer attribute have arithmetic evaluation (see `let') done when the variable is assigned to. When displaying values of variables, -f displays a function's name and definition. The -F option restricts the display to function name only. Using `+' instead of `-' turns off the given attribute instead. When used in a function, makes NAMEs local, as with the `local' command.Obsolete. See `declare'.Create a local variable called NAME, and give it VALUE. LOCAL can only be used within a function; it makes the variable NAME have a visible scope restricted to that function and its children.Output the ARGs. If -n is specified, the trailing newline is suppressed. If the -e option is given, interpretation of the following backslash-escaped characters is turned on: \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits You can explicitly turn off the interpretation of the above characters with the -E option.Enable and disable builtin shell commands. This allows you to use a disk command which has the same name as a shell builtin without specifying a full pathname. If -n is used, the NAMEs become disabled; otherwise NAMEs are enabled. For example, to use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. On systems supporting dynamic loading, the -f option may be used to load new builtins from the shared object FILENAME. The -d option will delete a builtin previously loaded with -f. If no non-option names are given, or the -p option is supplied, a list of builtins is printed. The -a option means to print every builtin with an indication of whether or not it is enabled. The -s option restricts the output to the POSIX.2 `special' builtins. The -n option displays a list of all disabled builtins.Read ARGs as input to the shell and execute the resulting command(s).Getopts is used by shell procedures to parse positional parameters. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead.Exec FILE, replacing this shell with the specified program. If FILE is not specified, the redirections take effect in this shell. If the first argument is `-l', then place a dash in the zeroth arg passed to FILE, as login does. If the `-c' option is supplied, FILE is executed with a null environment. The `-a' option means to make set argv[0] of the executed process to NAME. If the file cannot be executed and the shell is not interactive, then the shell exits, unless the shell option `execfail' is set.Exit the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Logout of a login shell.fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, then vi. -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first). With the `fc -s [pat=rep ...] [command]' format, the command is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command.For each NAME, the full pathname of the command is determined and remembered. If the -p option is supplied, PATHNAME is used as the full pathname of NAME, and no path search is performed. The -r option causes the shell to forget all remembered locations. The -d option causes the shell to forget the remembered location of each NAME. If the -t option is supplied the full pathname to which each NAME corresponds is printed. If multiple NAME arguments are supplied with -t, the NAME is printed before the hashed full pathname. The -l option causes output to be displayed in a format that may be reused as input. If no arguments are given, information about remembered commands is displayed.Display helpful information about builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise a list of the builtins is printed. The -s option restricts the output for each builtin command matching PATTERN to a short usage synopsis.Display the history list with line numbers. Lines listed with with a `*' have been modified. Argument of N says to list only the last N lines. The `-c' option causes the history list to be cleared by deleting all of the entries. The `-d' option deletes the history entry at offset OFFSET. The `-w' option writes out the current history to the history file; `-r' means to read the file and append the contents to the history list instead. `-a' means to append history lines from this session to the history file. Argument `-n' means to read all history lines not already read from the history file and append them to the history list. If FILENAME is given, then that is used as the history file else if $HISTFILE has a value, that is used, else ~/.bash_history. If the -s option is supplied, the non-option ARGs are appended to the history list as a single entry. The -p option means to perform history expansion on each ARG and display the result, without storing anything in the history list. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise.Send the processes named by PID (or JOBSPEC) the signal SIGSPEC. If SIGSPEC is not present, then SIGTERM is assumed. An argument of `-l' lists the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed. Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and, if you have reached the limit on processes that you can create, you don't have to start a process to kill another one.Each ARG is an arithmetic expression to be evaluated. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. If the last ARG evaluates to 0, let returns 1; 0 is returned otherwise.One line is read from the standard input, or from file descriptor FD if the -u option is supplied, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. If the -r option is given, this signifies `raw' input, and backslash escaping is disabled. The -d option causes read to continue until the first character of DELIM is read, rather than newline. If the -p option is supplied, the string PROMPT is output without a trailing newline before attempting to read. If -a is supplied, the words read are assigned to sequential indices of ARRAY, starting at zero. If -e is supplied and the shell is interactive, readline is used to obtain the line. If -n is supplied with a non-zero NCHARS argument, read returns after NCHARS characters have been read. The -s option causes input coming from a terminal to not be echoed. The -t option causes read to time out and return failure if a complete line of input is not read within TIMEOUT seconds. If the TMOUT variable is set, its value is the default timeout. The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Causes a function to exit with the return value specified by N. If N is omitted, the return status is that of the last command. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed.For each NAME, remove the corresponding variable or function. Given the `-v', unset will only act on variables. Given the `-f' flag, unset will only act on functions. With neither flag, unset first tries to unset a variable, and if that fails, then tries to unset a function. Some variables cannot be unset; also see readonly.NAMEs are marked for automatic export to the environment of subsequently executed commands. If the -f option is given, the NAMEs refer to functions. If no NAMEs are given, or if `-p' is given, a list of all names that are exported in this shell is printed. An argument of `-n' says to remove the export property from subsequent NAMEs. An argument of `--' disables further option processing.The given NAMEs are marked readonly and the values of these NAMEs may not be changed by subsequent assignment. If the -f option is given, then functions corresponding to the NAMEs are so marked. If no arguments are given, or if `-p' is given, a list of all readonly names is printed. The `-a' option means to treat each NAME as an array variable. An argument of `--' disables further option processing.The positional parameters from $N+1 ... are renamed to $1 ... If N is not given, it is assumed to be 1.Read and execute commands from FILENAME and return. The pathnames in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed.Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators as well, and numeric comparison operators. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2.This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Print the accumulated user and system times for processes run from the shell.The command ARG is to be read and executed when the shell receives signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) the command ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed after every simple command. If the`-p' option is supplied then the trap commands associated with each SIGNAL_SPEC are displayed. If no arguments are supplied or if only `-p' is given, trap prints the list of commands associated with each signal. Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. `trap -l' prints a list of signal names and their corresponding numbers. Note that a signal can be sent to the shell with "kill -signal $$".For each NAME, indicate how it would be interpreted if used as a command name. If the -t option is used, `type' outputs a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or unfound, respectively. If the -p flag is used, `type' either returns the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. If the -a flag is used, `type' displays all of the places that contain an executable named `file'. This includes aliases, builtins, and functions, if and only if the -p flag is not also used. The -f flag suppresses shell function lookup. The -P flag forces a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed.Ulimit provides control over the resources available to processes started by the shell, on systems that allow such control. If an option is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes.The user file-creation mask is set to MODE. If MODE is omitted, or if `-S' is supplied, the current value of the mask is printed. The `-S' option makes the output symbolic; otherwise an octal number is output. If `-p' is supplied, and MODE is omitted, the output is in a form that may be used as input. If MODE begins with a digit, it is interpreted as an octal number, otherwise it is a symbolic mode string like that accepted by chmod(1).Wait for the specified process and report its termination status. If N is not given, all currently active child processes are waited for, and the return code is zero. N is a process ID; if it is not given, all child processes of the shell are waited for.The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1.The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed.Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. The return status is the return status of PIPELINE. The `-p' option prints the timing summary in a slightly different format. This uses the value of the TIMEFORMAT variable as the output format.Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns.The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true.Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero.Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero.Create a simple command invoked by NAME which runs COMMANDS. Arguments on the command line along with NAME are passed to the function as $0 .. $n.Run a set of commands in a group. This is one way to redirect an entire set of commands.Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'.The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION".Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value.BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directries given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. -n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated. dir adds DIR to the directory stack at the top, making it the new current working directory. You can see the directory stack with the `dirs' command.Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and cd's to the new top directory. +N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. -n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated. You can see the directory stack with the `dirs' command.Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. The -l flag specifies that `dirs' should not print shorthand versions of directories which are relative to your home directory. This means that `~/bin' might be displayed as `/homes/bfox/bin'. The -v flag causes `dirs' to print the directory stack with one entry per line, prepending the directory name with its position in the stack. The -p flag does the same thing, but the stack position is not prepended. The -c flag clears the directory stack by deleting all of the elements. +N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero.Toggle the values of variables controlling optional behavior. The -s flag means to enable (set) each OPTNAME; the -u flag unsets each OPTNAME. The -q flag suppresses output; the exit status indicates whether each OPTNAME is set or unset. The -o option restricts the OPTNAMEs to those defined for use with `set -o'. With no options, or with the -p option, a list of all settable options is displayed, with an indication of whether or not each is set.printf formats and prints ARGUMENTS under control of the FORMAT. FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output, character escape sequences which are converted and copied to the standard output, and format specifications, each of which causes printing of the next successive argument. In addition to the standard printf(1) formats, %b means to expand backslash escape sequences in the corresponding argument, and %q means to quote the argument in a way that can be reused as shell input. If the -v option is supplied, the output is placed into the value of the shell variable VAR rather than being sent to the standard output.For each NAME, specify how arguments are to be completed. If the -p option is supplied, or if no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. The -r option removes a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications.Display the possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated.8L0tX`|H$lTPX  $`(.0123@678:t::;;==@K%2d %s %2d %s--no other directory%s: invalid timeout specification%s: invalid file descriptor specification%d: invalid file descriptor: %sersa:d:n:p:t:u:read_builtinread error: %d: %scan only `return' from a function or sourced script10editing-modefvcannot simultaneously unset a function and a variable%s: cannot unset%s: cannot unset: readonly %s%s: not an array variableSHELLOPTS%-15s %s set %co %s allexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognounsetonecmdphysicalpipefailprivilegedvixtraceoffPideclare -%s %s -%s afnp%s: not a function-rashift countfilename argument required%s: file not foundtrap -- %s %d trap -- %s %s lp%s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP(%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoftlimit%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling priorityfile sizepending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile lockscpkkdkke kfkki klkkmkknkpl lq llr0lsDlktPl\ludlv xlkx lagou`%c': invalid symbolic mode operatorrwx`%c': invalid symbolic mode characteru=%s,g=%s,o=%s Spoctal number -Sumask%s %04lo OPTARG?%s: invalid shell option name-s-ushopt %s %s psuoqcannot set and unset shell options simultaneouslycdable_varscdspellcheckhashcheckwinsizecmdhistdotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoregnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echoo4 o ol2 o+0ox8o(0@o4Lo \ohopoܑ|o+oo@oT2o\2oP2oooo`2pdp,pd24p @pLp,XpȖdpؑppPp4p p8Pimissing hex digit for \xwarning: %s: %s#'-+ 0v:hjlLtz`%s': missing format characterlld%s: illegal option -- %c %s: option requires an argument -- %c -r%s: invalid action nameabcdefgjko:prsuvA:G:W:P:S:X:F:C:warning: -F option may not work as you expectwarning: -C option may not work as you expectcomplete -o %s bashdefaultdirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-v-A %s arrayvarbindingenabledhelptopichostnamerunningsetoptsignalstopped%s %s -G-W-P-S-X-F-C%s: no completion specificationgroupjobusers sssss@attd`b c dc@tغef<$t0t tgt@jik<=;|&{("'nonereadline: %s: line %d: %s readline: %s $endif without matching $if$else found without matching $ifaudiblevisiblebell-stylecompletion-query-itemsisearch-terminatorskeymapset %s %s %s is set to `%s' "%s%s": "%s" %s%s outputs %s \M-\e\C-%c\C-?blink-matching-parenprefer-visible-bellterm=mode=# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on C-\M-unknown parser directiveno closing `"' in key bindingprefix-metaINPUTRC~/.inputrc/etc/inputrcControl-C-CTRL-MetaM-otherbind-tty-special-charsbyte-orientedconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprint-completions-horizontallyshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTab4t\Lp 8\pl7$8\0 LЇl܇PL 4l@hL`8DHPhtgL.Ј܈i# X< ( , 4 8 @H L T reverse-i-search)`':  readline: debug: insert_some_chars: count (%d) != col (%d) \%o~/-_=~.#$readline: readline_callback_read_char() called with no handler! coli amxnkmMT@7DCclcrdceiicimkDkHkIkdkekhklkrkummmopcvbvsx |T88(8\8L848 8H88        l  p@8  8Č08D8Ȍ ̌  (arg: %d) X%lu() <>;&|$"'`no previous substitutionunknown expansion errorevent not foundbad word specifiersubstitution failedunrecognized history modifier:$*%^ = ;&()|<>.history ~ ~virtual memory exhausted tc/etc/termcap   2Kn@?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELascii?*+@!alnumalphablankcntrldigitgraphlowerprintpunctupperxdigitNULSOHSTXETXEOTENQACKalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusminusdashperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeؚ (08/proc/sys/kernel/osreleaseFATAL: kernel too old FATAL: cannot determine kernel version /dev/fullunknown errorLOCPATHLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_PAPERLC_NAMELC_ADDRESSLC_TELEPHONELC_MEASUREMENTLC_IDENTIFICATION +3?HP[hw   Llocale_codeset != ((void *)0)findlocale.c/usr/lib/locale_nl_find_locale4 |̷8Ըn- cnt < (sizeof (_nl_value_type_LC_NUMERIC) / sizeof (_nl_value_type_LC_NUMERIC[0]))loadlocale.ccnt < (sizeof (_nl_value_type_LC_TIME) / sizeof (_nl_value_type_LC_TIME[0]))cnt < (sizeof (_nl_value_type_LC_COLLATE) / sizeof (_nl_value_type_LC_COLLATE[0]))cnt < (sizeof (_nl_value_type_LC_MONETARY) / sizeof (_nl_value_type_LC_MONETARY[0]))cnt < (sizeof (_nl_value_type_LC_MESSAGES) / sizeof (_nl_value_type_LC_MESSAGES[0]))cnt < (sizeof (_nl_value_type_LC_PAPER) / sizeof (_nl_value_type_LC_PAPER[0]))cnt < (sizeof (_nl_value_type_LC_NAME) / sizeof (_nl_value_type_LC_NAME[0]))cnt < (sizeof (_nl_value_type_LC_ADDRESS) / sizeof (_nl_value_type_LC_ADDRESS[0]))cnt < (sizeof (_nl_value_type_LC_TELEPHONE) / sizeof (_nl_value_type_LC_TELEPHONE[0]))cnt < (sizeof (_nl_value_type_LC_MEASUREMENT) / sizeof (_nl_value_type_LC_MEASUREMENT[0]))cnt < (sizeof (_nl_value_type_LC_IDENTIFICATION) / sizeof (_nl_value_type_LC_IDENTIFICATION[0]))category == __LC_CTYPE/SYS__nl_intern_locale_dataUo. Lh<@T`|Ī̪  archmapped == &headmaploadarchive.c((((ps) - 1) & (ps)) == 0)last->next == mappedranges[cnt].from >= from_nl_archive_subfreeres/usr/lib/locale/locale-archive_nl_load_locale_from_archiveANSI_X3.4-19684 |̷8Ը%s%s%s:%u: %s%sAssertion `%s' failed. Unexpected error. OUTPUT_CHARSETcharset=LANGUAGE.momessages/usr/share/localellillollullxllXI/locale.aliasiso" '+"5                        plural=nplurals= ȯܯl != ((void *)0)cxa_atexit.c__new_exitfnUUUU?3333*$I$qtEUUU;$I8^Cy 0 ,d! p= ^B{ I$ B|uPq  UUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqqinfinitynan d'@Bʚ; d'o#ſt[Am-jd8n헧?O>. 8/t#ڰͼ3&N|.[Ӿr؇/PkpnJؕnq&fƭ$6ZB<TcsUe(U܀n_S  62kg /SPto_outpunct0 <= n && n <= 9../locale/outdigits.h*** %n in writable segment detected *** ((&mbstate)->__count == 0)vfprintf.cs->_flags2 & 4*** invalid %N$ use detected *** (nil)_IO_vfprintf_internaloutdigit_valuepĦTxP(tL$|t$tL$|t$ܛt|d,tL$|t$Dd,tL$|t$DP0 d,tL$|t$Dؘ       D 48 @ \ Й  x ܗ x NANINFNANINFinfnan0.0001*decimal != '\0' && decimalwc != L'\0'printf_fphex.c__printf_fphex(((fmt[i]) & ~0x7f) == 0)fxprintf.c__fxprintf 0000000000000000 0000000000000000status == __codecvt_partialwfileops.c_IO_wfile_underflow u TB E ) 2 h? d 7  r @ е j i d] <` j u TB H6 ) 2 h? d 7  s @ е j i d] |` j u TB 6 ) 2 h? d 7  s @ е j i d] <` j fcts.towc_nsteps == 1iofwide.cfcts.tomb_nsteps == 1_IO_fwide4L K J J J L J  U @ P \ Й T  x ܗ x LIBC_FATAL_STDERR_======= Backtrace: ========= ======= Memory map: ======== /proc/self/maps,ccs=fileops.c_IO_new_file_fopen u p <{ @ g d k  r o H j i d] <` j u p d @ g c [  s l] H j i d] |` j u p ` @ g _ (]  s o H j i d] <` j offset >= oldendstrops.cenlarge_userbuf @ P \ Й T  x ܗ x *** glibc detected *** %s: %s: 0x%s *** corrupted double-linked listmalloc: top chunk is corruptmalloc: using debugging hooksCHECK_TOP_PAD_PERTURB_MMAP_MAX_TRIM_THRESHOLD_MMAP_THRESHOLD_munmap_chunk(): invalid pointerfree(): invalid pointerfree(): invalid next size (fast)free(): invalid next size (normal)free(): invalid sizedouble free or corruption (fasttop)double free or corruption (top)double free or corruption (out)double free or corruption (!prev)malloc(): memory corruption (fast)malloc(): memory corruptionrealloc(): invalid pointerrealloc(): invalid old sizerealloc(): invalid next sizeArena %d: system bytes = %10u in use bytes = %10u Total (incl. mmap): max mmap regions = %10u max mmap bytes = %10lu Unknown error Real-time signal %dUnknown signal %dstatus == __GCONV_OK || status == __GCONV_EMPTY_INPUT || status == __GCONV_ILLEGAL_INPUT || status == __GCONV_INCOMPLETE_INPUT || status == __GCONV_FULL_OUTPUTmbrtowc.c((data.__statep)->__count == 0)__mbrtowcwcrtomb.c__wcrtombdata.__outbuf[-1] == '\0'wcsrtombs.cdata.__outbuf != (unsigned char *) dst__wcsrtombsresult > 0mbsnrtowcs.c__mbsnrtowcs((uintptr_t) table) % __alignof__ (table[0]) == 0../string/strcoll_l.c((uintptr_t) weights) % __alignof__ (weights[0]) == 0((uintptr_t) extra) % __alignof__ (extra[0]) == 0((uintptr_t) indirect) % __alignof__ (indirect[0]) == 0__wcscoll_lANSI_X3.4-1968//TRANSLITT( ( ((wchar_t *) data.__outbuf)[-1] == L'\0'mbsrtowcs_l.c__mbsrtowcs_l%[^0-9,+-]%hu:%hu:%huM%hu.%hu.%hu%n/etc/localtimeUniversalUTCGMTnum_types == 2tzfile.cnum_types == 1__extension__ ({ size_t __s1_len, __s2_len; (__builtin_constant_p (&zone_names[info->idx]) && __builtin_constant_p (__tzname[tp->tm_isdst]) && (__s1_len = strlen (&zone_names[info->idx]), __s2_len = strlen (__tzname[tp->tm_isdst]), (!((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) || __s1_len >= 4) && (!((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) || __s2_len >= 4)) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__builtin_constant_p (&zone_names[info->idx]) && ((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) && (__s1_len = strlen (&zone_names[info->idx]), __s1_len < 4) ? (__builtin_constant_p (__tzname[tp->tm_isdst]) && ((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__extension__ ({ __const unsigned char *__s2 = (__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]); register int __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[0] - __s2[0]); if (__s1_len > 0 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[1] - __s2[1]); if (__s1_len > 1 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[2] - __s2[2]); if (__s1_len > 2 && __result == 0) __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[3] - __s2[3]); } } __result; }))) : (__builtin_constant_p (__tzname[tp->tm_isdst]) && ((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) && (__s2_len = strlen (__tzname[tp->tm_isdst]), __s2_len < 4) ? (__builtin_constant_p (&zone_names[info->idx]) && ((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__extension__ ({ __const unsigned char *__s1 = (__const unsigned char *) (__const char *) (&zone_names[info->idx]); register int __result = __s1[0] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[0]; if (__s2_len > 0 && __result == 0) { __result = (__s1[1] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[1]); if (__s2_len > 1 && __result == 0) { __result = (__s1[2] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[2]); if (__s2_len > 2 && __result == 0) __result = (__s1[3] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[3]); } } __result; }))) : __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst])))); }) == 0../TZDIRTZifposixrules__tzfile_compute__tzfile_read/usr/share/zoneinfo%m/%d/%y%Y-%m-%d%I:%M:%S %pgetgrent_rsetgrentendgrentgetpwent_rsetpwentendpwentgetpwnam_rgetpwuid_rself->tid != ppid../nptl/sysdeps/unix/sysv/linux/fork.c((struct pthread *)__builtin_thread_pointer () - 1)->tid == ppid__libc_fork/proc/sys/kernel/ngroups_max/proc/sys/kernel/rtsig-maxnum >= 0regexec.cnode->next == ((void *)0)regcomp.cleft > -1right > -1!((node->token.type) & 8)16 >= pstr->mb_cur_maxregex_internal.cUTF-8No previous regular expressionerr == REG_ESPACEregs_allocated == 2regs->num_regs >= nregspmatch[0].rm_so == startre_search_stubbuild_wcs_upper_bufferbuild_wcs_buffercheck_matchingpop_fail_stackre_copy_regsparse_bracket_explink_nfa_nodesSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_POSIX_V6_ILP32_OFF32POSIX_V6_ILP32_OFFBIG-D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64-D_LARGEFILE64_SOURCEglibc 2.7NPTL 2.7/bin:/usr/bina1->source_addr.ss_family == 2../sysdeps/posix/getaddrinfo.ca2->source_addr.ss_family == 2a1->source_addr.ss_family == 10a2->source_addr.ss_family == 10hostsdns [!UNAVAIL=return] filesgethostbyname3_rgethostbyname2_rgetcanonname_rorig_name != ((void *)0)/etc/gai.conflabelreloadyesprecedence((((__const uint32_t *) (sin6->sin6_addr.in6_u.u6_addr32))[0] == 0) && (((__const uint32_t *) (sin6->sin6_addr.in6_u.u6_addr32))[1] == 0) && (((__const uint32_t *) (sin6->sin6_addr.in6_u.u6_addr32))[2] == (__extension__ ({ register unsigned int __bsx = (0xffff); ((((__bsx) & 0xff000000u) >> 24) | (((__bsx) & 0x00ff0000u) >> 8) | (((__bsx) & 0x0000ff00u) << 8) | (((__bsx) & 0x000000ffu) << 24)); }))))canonname == ((void *)0)getaddrinfogaih_inetrfc3484_sort ``   2 `` ((tcpudpraw*Of(BOnAddress family for hostname not supportedTemporary failure in name resolutionBad value for ai_flagsNon-recoverable failure in name resolutionai_family not supportedMemory allocation failureNo address associated with hostnameName or service not knownServname not supported for ai_socktypeai_socktype not supportedSystem errorProcessing request in progressRequest canceledRequest not canceledAll requests doneInterrupted by a signalParameter string not correctly encodedinvalid open64 call: O_CREAT without mode__libc_errno != 34 || buf != ((void *)0) || size != 0../sysdeps/unix/sysv/linux/getcwd.c__getcwdstdoutstderr/proc/self/fd//dev/pts/dev/dev/logsyslog: unknown facility/priority: %xout of memory [<%d>%h %e %T [%d]/dev/console%s /proc/meminfoMemFree: %ld kBMemTotal: %ld kB/proc/stat/proc/cpuinfoprocessor/sys/devices/system/cpu/etc/resolv.conflibnss_.solibnss_files.so.2_nss_SUCCESSUNAVAILNOTFOUNDTRYAGAINCONTINUEillegal status in __nss_next/etc/nsswitch.confnis [NOTFOUND=return] filesaliasesethersgroupP9hostsL9netgroupnetworkspasswdT9protocolspublickeyrpcservices:shadowcompat [NOTFOUND=return] filespasswd+0x-0x[0x*** %s ***: %s terminated libcidn.so.1idna_to_ascii_lzidna_to_unicode_lzlzxn--gethostbyaddr_rgetservbyname_rgetservent_rsetserventendserventifa_data_ptr <= (char *) &ifas[newlink + newaddr] + ifa_data_size../sysdeps/unix/sysv/linux/ifaddrs.cgetifaddrs((uintptr_t) len & (__alignof__ (*len) - 1)) == 0nscd_getgr_r.cnscd_getgr_rsock == -1nscd_getai.c__nscd_getaiservices/var/run/nscd/socketmapped->counter == 0nscd_helper.c__nscd_unmapLD_WARNLD_LIBRARY_PATHLD_BIND_NOWLD_BIND_NOTLD_DYNAMIC_WEAKLD_PROFILE_OUTPUT/etc/suid-debugMALLOC_CHECK_LD_ASSUME_KERNEL/var/tmp/var/profileswphalfthumb26bitfast-multfpavfpedspjavaiwmmxtGCONV_PATHGETCONF_DIRHOSTALIASESLD_AUDITLD_DEBUGLD_DEBUG_OUTPUTLD_DYNAMIC_WEAKLD_LIBRARY_PATHLD_ORIGIN_PATHLD_PRELOADLD_PROFILELD_SHOW_AUXVLD_USE_LOAD_BIASLOCALDOMAINLOCPATHMALLOC_TRACENIS_PATHNLSPATHRESOLV_HOST_CONFRES_OPTIONSTMPDIRTZDIR_dl_open_hookGLIBC_PRIVATEirreversible != ((void *)0)gconv.coutbuf != ((void *)0) && *outbuf != ((void *)0)__gconvderiv->steps[cnt].__shlib_handle != ((void *)0)gconv_db.cstep->__shlib_handle != ((void *)0)step->__end_fct == ((void *)0)result[step_cnt].__shlib_handle != ((void *)0)free_derivationgen_steps__gconv_release_stepelem != ((void *)0)gconv_conf.ccwd != ((void *)0)modulegconv-modulesISO-10646/UCS4/=INTERNAL->ucs4=ucs4->INTERNALUCS-4LE//=INTERNAL->ucs4le=ucs4le->INTERNALISO-10646/UTF8/=INTERNAL->utf8=utf8->INTERNALISO-10646/UCS2/=ucs2->INTERNAL=INTERNAL->ucs2ANSI_X3.4-1968//=ascii->INTERNAL=INTERNAL->asciiUNICODEBIG//=ucs2reverse->INTERNAL=INTERNAL->ucs2reverse/usr/lib/gconv__gconv_get_pathUCS4//ISO-10646/UCS4/UCS-4//ISO-10646/UCS4/UCS-4BE//ISO-10646/UCS4/CSUCS4//ISO-10646/UCS4/ISO-10646//ISO-10646/UCS4/10646-1:1993//ISO-10646/UCS4/10646-1:1993/UCS4/ISO-10646/UCS4/OSF00010104//ISO-10646/UCS4/OSF00010105//ISO-10646/UCS4/OSF00010106//ISO-10646/UCS4/WCHAR_T//INTERNALUTF8//ISO-10646/UTF8/UTF-8//ISO-10646/UTF8/ISO-IR-193//ISO-10646/UTF8/OSF05010001//ISO-10646/UTF8/ISO-10646/UTF-8/ISO-10646/UTF8/UCS2//ISO-10646/UCS2/UCS-2//ISO-10646/UCS2/OSF00010100//ISO-10646/UCS2/OSF00010101//ISO-10646/UCS2/OSF00010102//ISO-10646/UCS2/ANSI_X3.4//ANSI_X3.4-1968//ISO-IR-6//ANSI_X3.4-1968//ANSI_X3.4-1986//ANSI_X3.4-1968//ISO_646.IRV:1991//ANSI_X3.4-1968//ASCII//ANSI_X3.4-1968//ISO646-US//ANSI_X3.4-1968//US-ASCII//ANSI_X3.4-1968//US//ANSI_X3.4-1968//IBM367//ANSI_X3.4-1968//CP367//ANSI_X3.4-1968//CSASCII//ANSI_X3.4-1968//OSF00010020//ANSI_X3.4-1968//UNICODELITTLE//ISO-10646/UCS2/UCS-2LE//ISO-10646/UCS2/UCS-2BE//UNICODEBIG//cnt < sizeof (map) / sizeof (map[0])gconv_builtin.c__gconv_get_builtin_trans  l 8 L ph   t    4 $ outbufstart == ((void *)0)../iconv/skeleton.cinptr - bytebuf > (state->__count & 7)../iconv/loop.cinend != &bytebuf[4]inend - inptr > (state->__count & ~7)inend - inptr <= 7inend - *inptrp < 4*outptrp + 4 > outendgconv_simple.cinend != &bytebuf[6]outbuf == outerrnstatus == __GCONV_FULL_OUTPUT__gconv_transform_internal_ucs2reverseinternal_ucs2reverse_loop_single__gconv_transform_ucs2reverse_internalucs2reverse_internal_loop_single__gconv_transform_internal_ucs2internal_ucs2_loop_single__gconv_transform_ucs2_internalucs2_internal_loop_single__gconv_transform_utf8_internalutf8_internal_loop_single__gconv_transform_internal_utf8internal_utf8_loop_single__gconv_transform_internal_asciiinternal_ascii_loop_single__gconv_transform_ascii_internal__gconv_transform_ucs4le_internalucs4le_internal_loopucs4le_internal_loop_unaligned__gconv_transform_internal_ucs4leinternal_ucs4le_loop_unaligned__gconv_transform_ucs4_internal__gconv_transform_internal_ucs4gconv_trans_contextgconv_transgconv_trans_initgconv_trans_endtrans->name != ((void *)0)gconv_trans.c__gconv_translit_findGCONV_PATH/usr/lib/gconv/gconv-modules.cacheobj->counter > 0gconv_dl.cfound->handle == ((void *)0)gconvgconv_initgconv_enddo_release_shlib__gconv_find_shlib     `     `  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ~~~~>>xx(( 8HHHHHIupperloweralphadigitxdigitspaceprintgraphblankcntrlpunctalnumtouppertolowerU  x ܫGS`,l04<DLT\`,l00123456789I#N@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ 23IRRSS                    " $ % & / 5 6 7 9 : < D G H I _ ` a b c !!!!! ! ! ! !!!!!!!!!!!!!!!"!$!&!(!,!-!.!/!0!1!3!4!9!E!F!G!H!I!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!""""#"6"<"d"e"j"k"""$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$#$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%,%4%<%%t*u*v*00Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2222222222222222q3r3s3t3u3v333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333) MNOPRTUVWYZ[\_`abcdefhijk  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    !"#$%&'()*+,-./0123456789;<=>@ABCDFJKLMNOPRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ %,37:>BFJNRVZ^aeimquy} !#%).38;@EHKNQTWZ]`cgjmpsv{ "&+158<ADGJMPTY]`diosvz !&+05:?DIMRW[_cgkpsw| %+17=CIOUY]aeimquy~ #(-27<AFKPUZ_dinsx} "',16;>ADGJMPSVY\_dhmpsy !',049=AEIMQUY]aflptx| &*.26:>BFJNRVZ^bflptx~              ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i k n q t w z }          " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y |          ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i l o r u x { ~          # & ) , / 2 5 8 ; > A D G J M P S V Y \ _ b e h k n q t w z }          " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y |    !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz} (C)<<-(R)u,>> 1/4 1/2 3/4 AExssaeIJij'nOEOEoeoesLJLjljNJNjnjDZDzdz'^'`_:~ -------'','"",,"+o...... ``````<>!!/???!!? RsEURa/ca/sCc/oc/ugHHHhIILlNNoPQRRRTEL(TM)ZOhmZBCeeEFMoiDdeij 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm<--><-><==><=>-/\*|:~<=>=<<>><<<>>>NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUSSPDEL_NL(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(0)-|+++++++++o::====== =(21)(22)(23)(24)(25)(26)(27)(28)(29)(30)(31)(32)(33)(34)(35)(36)(37)(38)(39)(40)(41)(42)(43)(44)(45)(46)(47)(48)(49)(50)hPadaAUbaroVpcpAnAuAmAkAKBMBGBcalkcalpFnFuFugmgkgHzkHzMHzGHzTHzulmldlklfmnmummmcmkmmm^2cm^2m^2km^2mm^3cm^3m^3km^3m/sm/s^2PakPaMPaGParadrad/srad/s^2psnsusmspVnVuVmVkVMVpWnWuWmWkWMWa.m.BqcccdC/kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbfffiflffifflst+___,.;:?!(){}#&*+-<>=\$%@!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefgijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzACDGJKNOPQSTUVWXYZabcdfhijkmnpqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABDEFGJKLMNOPQSTUVWXYabcdefghijklmnopqrstuvwxyzABDEFGIJKLMOSTUVWXYabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789012345678901234567890123456789012345678959056789?^[yY]^[nN]ltܫ.@u'u'ܫx.ܫSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%a %b %e %H:%M:%S %Z %YSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%a %b %e %H:%M:%S %Z %YoЯԯدܯ$048<@DHLPTX\`ht|@Ȱ̰аT ,<L\l|Ա <`pв @d|س DhtԴLLLLL0Lܫ)ܫ%p%t%g%t%m%t%fܫ%a%N%f%N%d%N%b%N%s %h %e %r%N%C-%z %T%N%c%N ܫ+%c %a %lܫܫISO/IEC 14652 i18n FDCC-setISO/IEC JTC1/SC22/WG20 - internationalizationC/o Keld Simonsen, Skt. Jorgens Alle 8, DK-1615 Kobenhavn VKeld Simonsenkeld@dkuug.dk+45 3122-6543+45 3325-6543ISO1.01997-12-20i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999Lȹ̹йܹܫTTܫ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~libc$l_next == ((void *)0)file too shortcannot read file datainvalid ELF headerELF file data encoding not little-endianELF file version ident does not match current oneELF file OS ABI invalidinternal errorELF file version does not match current oneonly ET_DYN and ET_EXEC can be loadedELF file's phentsize not the expected size trying file=%s cannot stat shared objectfile=%s [%lu]; generating link map r->r_state == RT_ADDcannot create shared object descriptorELF load command address/offset not properly alignedcannot dynamically load executablecannot change memory protectionscannot map zero-fill pagesELF load command alignment not page-alignedcannot allocate TLS data structures for initial threadobject file has no loadable segmentsfailed to map segment from shared objectobject file has no dynamic sectioninfo[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7dynamic-link.hinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)shared object cannot be dlopen()edcannot allocate memory for program headercannot enable executable stack as shared object requirescannot close file descriptor dynamic: 0x%0*lx base: 0x%0*lx size: 0x%0*Zx entry: 0x%0*lx phdr: 0x%0*lx phnum: %*u cannot create searchlistcannot create search path arraysystem search pathpelem->dirname[0] == '/':;lib(l)->l_name[0] == '\0'cannot create RUNPATH/RPATH copyRPATHRUNPATHnsid >= 0nsid < 1 file=%s [%lu]; needed by %s [%lu] find library=%s [%lu]; searching wrong ELF class: ELFCLASS64cannot open shared object fileexpand_dynamic_string_token./_dl_map_objectadd_name_to_objectlose_dl_map_object_from_fdelf_get_dynamic_info_dl_init_paths/lib//usr/lib/ GNUELF search cache=%s /etc/ld.so.cacheld.so-1.7.0glibc-ld.so.cache1.1cache != ((void *)0)dl-cache.c_dl_load_cache_lookup(bitmask_nwords & (bitmask_nwords - 1)) == 0dl-lookup.cversion->filename == ((void *)0) || ! _dl_name_match_p (version->filename, map)do-lookup.hsymbol=%s; lookup in file=%s [%lu] version == ((void *)0) || (flags & ~(DL_LOOKUP_ADD_DEPENDENCY | DL_LOOKUP_GSCOPE_LOCK)) == 0version != ((void *)0)

(no version symbols)symbol , version not defined in file with link time referencerelocation errorsymbol lookup error file=%s [%lu]; needed by %s [%lu] (relocation dependency) normalbinding file %s [%lu] to %s [%lu]: %s symbol `%s' [%s] _dl_setup_hashundefined symbol: _dl_lookup_symbol_xcheck_match! "could not map page for fixup"../ports/sysdeps/arm/dl-machine.hmap->l_tls_modid <= dtv[-1].counterdl-reloc.ccannot allocate memory in static TLS block (lazy) relocation processing: %s%s cannot make segment writable for relocation%s: Symbol `%s' has different size in shared object, consider re-linking R_ARM_PC24 relocation out of range%s: no PLTREL found in object %s %s: out of memory to store relocation results for %s cannot restore segment prot after reloccannot apply additional memory protection after relocationfix_bad_pc24_dl_nothread_init_static_tlsunexpected reloc type 0xunexpected PLT reloc type 0xDYNAMIC LINKER BUG!!!error while loading shared libraries%s: %s: %s%s%s%s%s continuedfatal%s: error: %s: %s (%s) pid >= 0 && sizeof (pid_t) <= 4dl-misc.cniov < 64! "invalid format specifier"_dl_debug_vdprintf.profile%s: cannot open file: %s %s: cannot create file: %s %s: file is no correct profile data file for `%s' %s: cannot map file: %s Out of memory while initializing profiler %s: cannot stat file: %s idx == 0dl-tls.cdlopencannot create TLS data structuresresult <= _dl_tls_max_dtv_idx + 1result == _dl_tls_max_dtv_idx + 1map->l_tls_modid == cntmap->l_tls_blocksize >= map->l_tls_initimage_sizelistp != ((void *)0)_dl_add_to_slotinfo_dl_allocate_tls_init_dl_next_tls_modid/proc/self/exelinkval[0] == '/'../sysdeps/unix/sysv/linux/dl-origin.c_dl_get_origininvalid mode for dlopen()no more namespaces available for dlmopen()invalid target namespace in dlmopen()_dl_debug_initialize (0, args.nsid)->r_state == RT_CONSISTENTdl-open.ccannot extend global scopens == l->l_ns_dl_debug_initialize (0, args->nsid)->r_state == RT_CONSISTENT(call_map)->l_name[0] == '\0'empty dynamic string token substitutionmode & 0x00004opening file=%s [%lu]; direct_opencount=%u cannot create scope listimap->l_need_tls_init == 0TLS generation counter wrapped! Please report this._dl_opendl_open_worker! should_be_theredl-close.cold_map->l_tls_modid == idx closing file=%s; direct_opencount=%u idx == nloaded(*lp)->l_idx >= 0 && (*lp)->l_idx < nloadedjmap->l_idx >= 0 && jmap->l_idx < nloadedimap->l_ns == nsidimap->l_type == lt_loaded && (imap->l_flags_1 & 0x00000008) == 0 calling fini: %s [%lu] tmap->l_ns == nsiddlcloseimap->l_type == lt_loaded file=%s [%lu]; destroying link map TLS generation counter wrapped! Please report as described in . map->l_init_calledshared object not open_dl_close_dl_close_workerremove_slotinfoto_inpunctcnt < (((uint32_t) (*_nl_current_LC_CTYPE)->values[((int) (_NL_CTYPE_MB_CUR_MAX) & 0xffff)].word))vfscanf.c_IO_vfscanf_internalinvalid mode parameterDST not allowed in SUID/SGID programsdl-deps.ccannot load auxiliary `%s' because of empty dynamic string token substitution load auxiliary object=%s requested by file=%s load filtered object=%s requested by file=%s cannot allocate dependency listmap->l_searchlist.r_list == ((void *)0)cannot allocate symbol search listFilters not supported with LD_TRACE_PRELINKINGcnt <= nlistmap->l_searchlist.r_list[0] == map_dl_map_object_deps((reloc->r_info) & 0xff) == 22dl-runtime.c_dl_profile_fixup_dl_fixup calling init: %s calling preinit: %s j < nmapsdl-fini.ci < nloadedns != 0 || i == nloaded_dl_fini_dl_sort_finichecking for version `%s' in file %s [%lu] required by file %s [%lu] no version information available (required by def_offset != 0dl-version.cunsupported version of Verdef recordweak version `' not found (required by version ` of Verneed record needed != ((void *)0)cannot allocate version reference table_dl_check_map_versionsmatch_symbolRTLD_NEXT used in code not dynamically loaded d'@Bʚ;suu|JhLTPUVVVtW@YhYYY Z_\_]^_`_bbccc hikk$l mm@nosvvw,wwwwwwlxxyyyhyyy\zzzz\{`{`{`{`{`{\{d{d{d{`{{{||4}}d~~~h_̀_ |thH؎(X(  _ $   _ ؊ ȋ T?%@Hpl*| ܕȖ(0 \httl$p(Ll8@8@04T8\< X\H`pl LDdH\`d<tPX`%+$/ \4 @5_ d6 T7 RVHWW]]4^eePff|'? KLLMN XS8,_xx`X08Lp_?DlE0G J<x@00<40!_\\|\^^_ hhjk(kzR| $@BN@<@BB210/B` DBB BB h F||#́ 0`p$`p `p`p,( `p`p`p4  `pH)ЁL)|̑̑p`L$4,    ( 0 4 P<TlH{}LPTX\`dh l"p#t$x!|%&'(T><@-H{};܄(\)|& HHlx0$L0̢̣أXd(xL  ,<@lآaefhi@k n$pTrLt(u0v4x8BC,E\HIHPDTX+ Gl   $, dtp |4pDP B H ##  ;\ܵ9$\<,\ C 4\lB <\d`CD\ж@DL\ KT\$G\\(0N d\04Nl\4<Nt\< N|\Dhi\pi\зh\طpi\l\n \@P\XxH| \ԆH \b\b\\\0Ģ\H̚\\ ]p ]x ]l ]غ$],]P 4]Xdp <]lxp D]L]T]x \]TL d]Ȼ l] t]8@|]@x]X]dl]]Tl] ]]@ ](]<]] ]$4]@T]`t]ܧ]Ծ^ܾs ^^ ^DoT2$^h),^ChahBhehEhThhhHĢtXآ8iik$im,iC8in@ifHiX2PiuXit`iPli`xip$viix?-@xi, TТTKKT<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDl ,pܔ <Ș<<<<<<<<<<p  tȘh<DH4`LDܔ=LtPDTТTKKTdp8@,,,@,|4,Ȥ@,0Э4@$ |4,Td|@,d04dDDDDDD TDDTDDDDKKTDDDDDdDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\d̄@  (,,uT!^pxDP@` ďԏ(P  \ h   Ȑ Ԑ   HT`pБ ,8HTdp8 !В" #<$l%&ȓ'(8)*+̔,---4-H.d./8/0123ؕ4567(8@9d:T;|<=>0?h@[\\X]^ؘ^ _L`{{|0}`}~Ț @DHLPTX\dht x |        ěț̛Лԛ؛ܛ !",#8$D%T&`'l()*+,--̜-Ԝ-ܜ..//01234 567 8(94:0;<<L=X>l?|@[\\]ԝ^^_`{{0|@}L}`~4 |̷8ԸȬԬd   \@@  ``Xg\ (   ,8,L`p` $"@  D GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)GCC: (GNU) 4.2.4 (Gentoo 4.2.4 p1.0)(8$J!`h2ȫp}g8)hy<~KتgTl4S(M- >0GW8[4<trK,<[ - T&@  / 83I;lA(X,Y@ 7PbGEsW8 _de0 avE* 0eP` x '(T|Z`2<6(77, 9<L,B\Cx@D XFw*N+Ne5Q oB_ wPiTl[nT\ongupv|Py`T~ hXD`̚Pd ܝ0 `߼L DtpGx$$Hp, &@] 0,S\@P* -/ !;1 %;5+@8`H8L8M99Pt;Tx?Z0AxbC\cDiEnH p|Jv|MzdRr,Vߊ]a &dTlotHx<(|4$̀\(Ȳ́Lɸ|8̞*mhH ^\ d*)#P 3E>x TPK8A3gȌq4z̗ +ȣnĨx<t|1,8 _d@ #8  @$(!)l|+U |0H&5r\8| yA$G*|X0+X(?dxvJ!get_current_user_info+unset_bash_inputVunbind_argsldisable_priv_modeshell_is_restrictedmaybe_make_restrictedsh_exit'exit_shellmainsubshell_top_levelglobal_commandshell_environmentdebugging_modeexecuting login_shell2interactiveDinteractive_shellVstartup_statehcurrent_userdefault_buffered_inputshell_initializedcurrent_host_namehup_on_exitdebugging_login_shellcurrent_command_numberindirection_level shell_name shell_start_time' running_under_emacs9 no_line_editingK dump_translatable_strings] dump_po_stringso wordexp_only protected_mode posixly_correct long_args subshell_argc subshell_argv subshell_envp read_from_stdin!want_pending_command#!command_execution_string6!malloc_trace_at_exitAJ!Lparse_commandread_commandreader_loop25return_EOFyy_input_nameWstream_on_stackrestore_token_state#history_delimiting_charsNget_current_prompt_levelfset_current_prompt_levelreset_parserfree_pushed_string_inputinitialize_bash_inputrestore_parser_stateBsave_token_statemsave_parser_statefind_reserved_wordinit_yy_iowith_input_from_streamwith_input_from_stringwith_input_from_stdinyyerrortdecode_prompt_stringread_secondary_line gather_here_documents>)execute_variable_command)pop_stream)push_stream*parse_string_to_word_list+yyparse2EOF_Reached2bash_input63eof_encountered3primary_prompt3secondary_prompt3ps1_prompt4ps2_prompt 4prompt_string_pointer24current_prompt_stringD4expand_aliasesV4promptvarsh4extended_quotez4current_command_line_count4need_here_doc4yychar4yylval4yynerrs4current_readline_prompt4current_readline_line4current_readline_line_index5line_number!5stream_list45pushed_string_listW5word_token_alistz5other_token_alist5dstack5ignoreeof5eof_encountered_limittgfposix_initializestring_to_rlimtypeall_digits legal_alias_nameLcheck_binary_fileabsolute_pathnameget_group_arrayCgroup_membertilde_initializeget_group_list# bash_tilde_expand bash_tilde_find_word^ extract_colon_unit polite_directory_format make_absolutec full_pathname base_pathname absolute_program file_isdirf file_iswdir sh_validfd sh_unset_nodelay_mode move_to_high_fd check_dev_tty legal_identifierassignmentpcheck_identifierlegal_numberaprint_rlimtypesame_filebash_getcwd_errstry clean_simple_command&make_bare_simple_commandcmake_cond_commandmake_cond_nodemake_arith_command_make_pattern_listmake_commandmake_subshell_commandmake_until_commandmake_while_commandmake_if_commandomake_case_commandmake_group_commandmake_select_commandmake_for_commandAcommand_connectconnect_async_listmake_word_list_make_simple_commandalloc_word_desccmd_initmake_function_defmake_redirectionmake_here_documentmake_word_flagsmake_bare_wordmake_word7make_arith_for_commandmake_word_from_tokenwdcachewlcacheE~Z print_word_list[ print_cond_command print_arith_command print_case_command_head print_select_command_headprint_for_command_headprint_simple_commandgnamed_function_string<make_command_stringiindirection_level_stringxtrace_print_arith_cmd&xtrace_print_cond_termxtrace_print_case_command_headxtrace_print_word_list xtrace_print_select_command_headKxtrace_print_for_command_headvxtrace_print_assignmentprint_command#the_printed_command5the_printed_command_sizeGcommand_string_indexت vdispose_word_descdispose_word" dispose_redirectsW dispose_words dispose_cond_node dispose_command? dispose_function_def_contentsf dispose_function_defh 5executing_line_numberIclose_fd_bitmapdispose_fd_bitmapMshell_execve{setup_async_signalsdispose_exec_redirectsnew_fd_bitmap^execute_command"execute_command_internal_,execute_shell_function1return_catch3match_ignore_case4stdin_redir"4this_command_name44the_printed_command_except_trapF4SBW4return_catch_flagi4return_catch_value{4last_command_exit_value4last_command_exit_signal4redirection_undo_list4exec_redirection_undo_list4subshell_environment4subshell_level4this_shell_function4current_fds_to_closeYBsv_tzsv_histignoresv_globignoresv_mailsv_path}stupidly_hack_special_variablesdispose_saved_dollar_varspop_dollar_vars&push_dollar_vars<delete_all_variablesedispose_var_contextdelete_all_contextspop_var_contextkill_all_local_variablesfind_tempenv_variablefind_function_deffind_functionvar_lookuppfind_variable_internalfind_variablesv_strict_posix#sv_ignoreeof~sv_histtimefmtsv_hostfilesv_comp_wordbreaks sv_ifsUpop_contextkpop_scopemerge_temporary_envpop_argsnpush_argsmake_funcname_visiblemap_over_funcsmap_overnew_var_contextpush_var_contextD push_context push_scope!sort_variables&"all_local_variables"all_visible_functions"all_shell_functions#all_array_variables4#local_exported_variablesL#all_exported_variablesd#all_visible_variables|#all_shell_variables#add_or_supercede_exported_var#update_export_env_inplaceJ$put_command_name_into_env$all_variables_matching_prefixF%unbind_function_def%dispose_variable%makunboundr&unbind_variable&unbind_func5'assign_in_env'bind_function_def](bind_function(make_new_array_variable )set_pipestatus_array)set_pipestatus_from_exitL*get_variable_valuey*make_variable_value(+bind_variable_value`-bind_variable-set_var_read_only-.bind_int_variable.bind_var_to_int/sh_set_lines_and_columns^/make_local_variable/make_local_array_variable#0set_if_notp0get_string_value0sv_locale0sv_opterr01sv_histcharsk1sv_history_control1sv_histsize2sv_terminalF2sh_get_env_value2get_random_number3print_var_function3print_var_value4print_func_listQ4print_assignment|4print_var_list4set_ppid 5set_pwdb5adjust_shell_level5sh_get_home_dirz7initialize_shell_variables;sv_optind,=maybe_make_export_env=dispose_used_env_vars?global_variables.?shell_variables@?shell_functionsR?temporary_envd?variable_context?dollar_vars?export_env?rest_of_argsAshell_function_defsAtempenv_assign_errorAdollar_dollar_pidAarray_needs_makingBshell_level- copy_wordO copy_redirect copy_redirects copy_word_list copy_commandcopy_function_def_contentscopy_function_def?>f command_errstr-programming_errorscommand_errorget_name_for_errorparser_error}internal_warningsys_errorAinternal_erroryfatal_errorreport_errorerr_readonlyerr_unboundvar;err_badarraysubdfile_errorA the_current_maintainerS gnu_error_formatG evalexpW find_flagreset_shell_flagsinitialize_flags$which_set_flagskchange_flagshell_flagsoptflagsmark_modified_vars(exit_immediately_on_error:disallow_filename_globbingLplace_keywords_in_env^read_but_dont_executepjust_one_commandunbound_vars_is_errorecho_input_at_readecho_command_at_executeno_invisible_varsnoclobberhashing_enabledforced_interactiveprivileged_modeasynchronous_notification$interactive_comments6no_symbolic_linksHfunction_trace_modeZerror_trace_modelpipefail_opt~brace_expansionhistory_expansionrestrictedrestricted_shelljobs_m_flag3[{ give_terminal_to stop_pipeline,start_pipeline@stop_making_childrenTget_job_by_pidunfreeze_jobs_listcount_all_jobsdescribe_pidset_tty_stateget_tty_stateNinitialize_job_control}kill_piddefault_tty_job_signalsignore_tty_job_signalsinitialize_job_signalsccleanup_dead_jobswait_forlwait_for_background_pidsreap_dead_jobswait_for_single_pidmake_childlast_made_pidlast_asynchronous_pidDalready_making_childrenVshell_ttyhcheck_window_sizer`number_of_argsgetifs remove_backslashes` strip_trailing_ifs_whitespace extract_array_assignment_list get_dollar_var_valuea list_rest_of_args unlink_fifo_list string_list_internalb string_list expand_string_to_string sub_append_string*mbstrlenfword_list_remove_quoted_nullsdequote_stringwdequote_listquote_stringyquote_escapesGde_backslash/setifspat_substcommand_substituteYget_word_from_stringX list_stringu!word_spliti"string_list_dollar_at#string_list_dollar_star$string_rest_of_args^$expand_assignment_string_to_string$expand_string_unsplit_to_stringD%string_quote_removal'expand_arith_string)do_assignment_no_expand)do_word_assignment)do_assignment-unclosed_pair`/char_is_quoted3skip_to_delimz5split_at_delims7extract_process_substP7extract_arithmetic_subst7extract_command_substRexpand_words_shellexpHRexpand_words_no_varsuRexpand_wordsRexpand_prompt_stringrSexpand_word_leave_quotedSexpand_word_unsplitSexpand_wordWexpand_string_assignmentXexpand_stringZexpand_string_unsplit"[cond_expand_wordY^ifs_vark^ifs_value^ifs_cmap^ifs_firstc^ifs_firstc_len_last_command_subst_pid_current_command_subst_pid\`allow_null_glob_expansionn`fail_glob_expansion`subst_assign_varlistw9phash_searchphash_removephash_flushphash_createphash_insertvhashed_filenames<hash_sizehash_stringQhash_buckethash_walkhash_disposehash_flushhash_createhash_removeNhash_searchhash_insert~hash_copy[ reset_mail_filesfree_mail_files%check_mail make_default_mailpath| remember_mail_dates reset_mail_timer time_to_check_mail mail_warning- trap_to_sighandlerrun_trap_cleanupsignal_is_trapped>signal_is_specialksignal_is_ignoredset_signal_ignoredsignal_in_progressset_sigint_handlerrestore_original_signalsreset_signal_handlers ignore_signalKrestore_default_signal run_interrupt_trap4run_return_trap_run_error_trapsrun_debug_traprun_exit_trap set_signal; set_return_trapd set_error_trap set_debug_trap signal_name run_pending_traps] trap_handler maybe_call_trap_handler decode_signal! initialize_traps trap_list original_signals pending_traps running_trap trap_saved_exit_value wait_signal_received  ungetc_with_restartset_bash_input_fdfd_is_bash_inputset_buffered_streambuffered_ungetcharbuffered_getchar4sync_buffered_stream~free_buffered_streamclose_buffered_streamclose_buffered_fd fd_to_buffered_stream4 with_input_from_buffered_stream open_buffered_stream duplicate_buffered_streaml save_bash_input check_bash_input getc_with_restart bash_input_fd_changed discard_unwind_frameBrun_unwind_frameiadd_unwind_protectbegin_unwind_frameremove_unwind_protectrun_unwind_protectsclear_unwind_protect_list!unwind_protect_mem  'should_ignore_glob_matches?quote_string_for_globbingsetup_ignore_patterns-setup_glob_ignoreignore_glob_matchesZshell_glob_filenamequote_globbing_charsunquoted_glob_pattern_pglob_dot_filenamesextended_globIR sigwinch_sighandlerset_signal_handler(unset_sigwinch_handler<set_sigwinch_handlerRtermsig_handlertermsig_sighandlerjump_to_top_levelthrow_to_top_level sigint_sighandler3reset_terminating_signalshinitialize_terminating_signalsinitialize_signalsQ top_levelc interrupt_stateu terminating_signal sigwinch_received interrupt_immediately terminate_immediately? top_level_mask[ ;test_binopgtest_unopunary_test- binary_test test_command(;shell_version_stringishow_shell_versiondist_versionpatch_levelbuild_versionrelease_statussccs_version, 3all_aliasesdelete_all_aliases.remove_aliasjfind_alias3alias_expand alias_expand_word get_alias_value$ initialize_aliases9 add_alias aliases alias_expand_all7 array_walkarray_remove#array_referencemarray_create_elementarray_rshiftarray_shift_elementSarray_createarray_copyarray_to_stringarray_dispose_elementarray_insert|array_assign_listarray_from_word_list array_flushS array_shift array_unshift_element array_quote: array_disposea array_to_assign' array_to_argv array_keys_to_word_list array_to_word_list1 array_patsub array_subrangeGELarray_expand_indexprint_array_assignmentskipsubscriptarray_variable_nameD array_variable_part array_keys get_array_valueV array_value valid_array_reference unbind_array_elementh assign_array_var_from_word_listM assign_compound_array_listoexpand_compound_array_assignment(assign_array_var_from_stringconvert_var_to_arrayfind_or_make_array_variableassign_array_from_stringobind_array_variableassign_array_elementbash_badsub_errmsg7Wbrace_expandbrace_arg_separator(_vbash_brace_completionee/bash_history_reinitVbash_history_disablelast_history_line<setup_history_ignoreehistory_numberbash_add_historyL check_add_historye maybe_add_history pre_process_line maybe_save_shell_historyW bash_history_enable bash_initialize_history load_history maybe_append_historyremember_on_historyhistory_lines_this_sessionhistory_lines_in_filehistory_control'command_oriented_history9current_command_first_line_savedKhist_last_line_added]hist_last_line_pushedohistory_expansion_inhibitedliteral_historyforce_append_historyhistory_reediting&hist_verify8dont_save_function_defs7av1g bash_dequote_text clear_hostname_listbash_directory_completion_matchesbind_keyseq_to_unix_commandbash_re_editfbash_groupname_completion_functionbash_servicename_completion_function command_word_completion_functionbash_default_completionget_hostname_list bashline_reinitialize+enable_hostname_completion4,initialize_readline~,posix_readline_initializel.bash_readline_initialized1perform_hostname_completion1no_empty_command_completion1force_fignore1hostname_list_initializedU*list_reverselist_length%list_appendmglobal_error_liststrip_trailingWxbcopyfind_token_in_aliststrcreplacestrsubysubstringfind_index_in_alist?find_string_in_alistemk_msgstrget_locale_varYlocaletranslocaleexpandset_lang&set_locale_varoset_default_langset_default_locale_varsset_default_locale= xfile_statususer_command_matchesexecutable_or_directory is_directory find_path_file find_user_command search_for_commandv executable_file check_hashed_filenames* dot_found_in_searchw'{fstdin_redirectsredirection_expand redirection_errorgdo_redirectionsAexpanding_redir<set_itemlist_dirty initialize_itemlist completions_to_stringlistfilter_stringlistclean_itemlistgen_compspec_completionsfprogrammable_completions(prog_completion_enabled:it_aliasesLit_arrayvars^it_bindingspit_builtinsit_commandsit_directoriesit_disabledit_enabledit_exportsit_filesit_functionsit_groupsit_hostnames$it_jobs6it_keywordsHit_runningZit_serviceslit_setopts~it_shoptsit_signalsit_stoppedit_usersit_variablesZprogcomp_sizeprogcomp_walkprogcomp_searchMcompspec_createvcompspec_copycompspec_disposeprogcomp_removeAprogcomp_disposeVprogcomp_flushiprogcomp_create~progcomp_insertprog_completes0Osh_syntaxtabsh_syntabsiz1>0xfreemxreallocxmalloc77<initialize_signames)signal_names8sb num_shell_builtinsstatic_shell_builtinsshell_builtinscurrent_builtinalias_doc"unalias_docIbind_docqbreak_doccontinue_docbuiltin_doccaller_doccd_doc9pwd_docacolon_doctrue_docfalse_doccommand_docdeclare_doc)typeset_docQlocal_docyecho_docenable_doceval_docgetopts_docexec_docAexit_docilogout_docfc_dochash_dochelp_doc history_doc1kill_docYlet_docread_docreturn_docset_docunset_doc!export_docIreadonly_docqshift_docsource_docdot_doctest_doctest_bracket_doc9times_docatrap_doctype_doculimit_documask_doc wait_doc) for_docQ arith_for_docy select_doc time_doc case_doc if_doc while_docA until_doci function_doc grouping_braces_doc fg_percent_doc arith_doc conditional_doc1 variable_help_docY pushd_doc popd_doc dirs_doc shopt_doc printf_doc! complete_docI compgen_doc4 ,unalias_builtinLalias_builtin+bind_builtin`,0vcontinue_builtinbreak_builtinloop_level breakingcontinuing"\builtin_builtin!caller_builtinL  pwd_builtin<cd_builtin cdspelling cdable_vars2w*%colon_builtincfalse_builtin"+d B command_builtine5 dollar_vars_changedset_dollar_vars_unchangedset_dollar_vars_changedread_octal%initialize_shell_builtinsbuiltin_address_internal?find_special_builtinnbuiltin_addressfind_shell_builtinset_working_directoryget_working_directory&remember_argskmake_builtin_argvbuiltin_usageno_optionsbuiltin_error>sh_wrerrorTsh_notbuiltin}sh_restrictedsh_erangesh_readonly sh_badpid* sh_invalidsigQ display_signal_list sh_invalidnum% sh_invalididL sh_invalidoptnames sh_invalidopt sh_notfound sh_neednumarg sh_needarg no_args8 get_exitstat get_numeric_arg the_current_working_directory last_shell_builtin this_shell_builtin4oBG local_builtint declare_builtin,wPxecho_builtinfxpg_echo!Toenable_builtin[6eval_builtinY\ ) source_file fc_execute_file maybe_execute_file sourcelevel^ngG parse_and_executeh parse_and_execute_cleanupparse_and_execute_level:vexec_builtinno_exit_on_failed_execBybash_logoutlogout_builtin,exit_builtin~ ;fc_builtin!hash_builtinhelp_builtin:Kdelete_last_historyhistory_builtin`kill_builtind^let_builtin 4get_directory_stackset_dirstack_elementget_dirstack_from_stringdirs_builtinQpopd_builtinpushd_builtin p read_builtin!Ireturn_builtin߼ mreset_shell_optionsunset_builtinEset_shelloptsminus_o_option_value+set_minus_o_optionvparse_shelloptsinitialize_shell_options get_minus_o_opts list_minus_o_opts set_builtin o_options set_var_attribute show_var_attributes show_name_attributes set_or_show_attributesreadonly_builtin8export_builtin6^shift_builtinprint_shift_errorNI^source_builtin$source_uses_path6source_searches_cwditest_builtin G~times_builtin trap_builtin4 describe_command| type_builtin!p ulimit_builtin8&parse_symbolic_modeumask_builtin1wait_builtinmwait_intr_buf4] Hgetopts_reset{getopts_builtinS reset_shopt_options$set_login_shell[shopt_listoptshopt_setoptget_shopt_optionsIshopt_builtin![ printf_builtin~*Hsh_getopt_restore_stateqsh_getoptsh_optarg(sh_optind:sh_opterrLsh_optopt^sh_badopt-/reset_internal_getoptinternal_getoptlist_optarglist_optoptlist_opttypelcurrentloptend7;1 compgen_builtincomplete_builtinH;Eunsetenvsetenv6putenvgetenv_getenv/+@5getmaxchildfgetmaxgroups H:sh_setlinebuf<Luinttostrinttostr5uitositosHMJzresetzsyncfd zreadintrkzreadzreadc9P#ttattrStt_setonechar~tt_setnoechott_seteightbittt_setnocanontt_setcbreak.ttsetattrgttcbreakttnocanontteightbitttnoechottonecharEttrestoreZttgetattrttsaveTsh_regmatch)ZAsh_statsh_eaccessbisnetconncnetopenfi .difftimevalxaddtimevaltimeval_to_cpu'timeval_to_secsprint_timevaln6sh_makepath p sh_canonpath.vsh_physpath,sh_realpath=z{sh_mktmpfd sh_mktmpfpsh_mktmpname%rmstrlist_walkstrlist_to_word_listnstrlist_from_word_liststrlist_sort!strlist_printcstrlist_prefix_suffixstrlist_removeEstrlist_disposemstrlist_flushstrlist_createstrlist_mergeTstrlist_copystrlist_resizestrlist_appendߊstrvec_lenstrvec_flush strvec_dispose6strvec_to_word_liststrvec_createstrvec_from_word_listWstrvec_copystrvec_sortstrvec_strcmp1strvec_removestrvec_resizeh_spname&sh_contains_shell_metassh_backslash_quote_for_double_quotesqsh_backslash_quotesh_un_double_quote2sh_mkdoublequotedsh_double_quotesh_single_quotePkansic_shouldquoteansic_quote=ansicstransiexpando%mailstatHkfmtulongfmtumax49xstrchrzcatfd&get_new_window_sizeȲgetcwdɸzwritew_rl_init_line_state_rl_set_the_linerl_save_staterl_restore_state_rl_keyseq_cxt_allocrl_initialize _rl_keyseq_cxt_dispose3 _rl_keyseq_chain_disposeZ _rl_dispatch_subseq _rl_dispatch _rl_dispatch_callbackM _rl_internal_char_cleanupc readline_internal_char readline_internal_teardown readline_internal_setupD rl_set_prompt readline rl_library_version rl_readline_version rl_gnu_readline_p rl_readline_state rl_editing_mode rl_insert_mode rl_promptrl_line_buffer#rl_point5rl_endGrl_markYrl_donekrl_pending_input}rl_dispatchingrl_explicit_argrl_numeric_argrl_last_funcrl_terminal_namerl_instreamrl_outstreamrl_startup_hookrl_pre_input_hook[rl_executing_keymapmrl_erase_empty_linerl_already_promptedrl_num_chars_to_readrl_line_buffer_lenrl_arg_sign rl_visible_prompt_lengthreadline_echoing_p1rl_key_sequence_lengthC_rl_kscxtq_rl_horizontal_scroll_mode_rl_mark_modified_lines_rl_bell_preference_rl_meta_flag_rl_convert_meta_chars_to_ascii_rl_output_meta_chars_rl_bind_stty_chars_rl_comment_begin_rl_parsing_conditionalized_out_rl_keymap*_rl_in_stream<_rl_out_streamN_rl_last_command_was_kill`_rl_eof_charrreadline_top_level_rl_dispatching_keymap4C_rl_vi_initialize_lined_rl_vi_reset_lastw_rl_vi_set_lastrl_vi_fWordrl_vi_bWord6rl_vi_eWordurl_vi_insertion_moderl_vi_start_insertingrl_vi_bracktypeOrl_vi_goto_markrl_vi_set_markNrl_vi_replacerl_vi_eof_mayberl_vi_overstrike_delete1 rl_vi_overstrike rl_vi_append_modeX rl_vi_check rl_vi_match@ rl_vi_char_search rl_vi_back_to_indent rl_vi_first_printM rl_vi_insert_beg rl_vi_rubout rl_vi_deletez rl_vi_change_charrl_vi_eword\rl_vi_bwordrl_vi_fwordrl_vi_end_word/rl_vi_prev_wordnrl_vi_next_word_rl_vi_textmod_commandrl_vi_redoorl_vi_domovefrl_vi_yank_torl_vi_change_to4rl_vi_substsrl_vi_delete_torl_vi_columnrl_vi_append_eol>rl_vi_putrl_vi_change_caserl_vi_arg_digit?_rl_vi_done_insertingUrl_vi_movement_moderl_vi_tilde_expandrl_vi_completerl_vi_searchQrl_vi_search_againrl_vi_fetch_historyrl_vi_yank_argrl_vi_undo_rl_vi_last_commandmZrl_add_funmap_entryrl_initialize_funmaprl_funmap_names{funmapfunmap_program_specific_entry_start`rl_discard_keymaprl_make_bare_keymaprl_make_keymaprl_copy_keymap[emacs_standard_keymapmemacs_meta_keymapemacs_ctlx_keymapvi_insertion_keymapvi_movement_keymap nrl_history_search_backwardrl_history_search_forwardTrl_noninc_reverse_search_againrl_noninc_forward_search_again_rl_nsearch_callback rl_noninc_reverse_search rl_noninc_forward_searchl _rl_nscxt2^ brl_tty_unset_default_bindings_rl_restore_tty_signals~_rl_disable_tty_signalsrltty_set_default_bindings^rl_tty_set_default_bindingsrl_stop_outputrl_restart_outputE rl_deprep_terminal rl_prep_terminalJ rl_prep_term_functionb rl_deprep_term_function2 rl_completion_mode_rl_free_match_list0rl_filename_completion_function7rl_username_completion_functionrl_completion_matchessrl_display_match_listf_rl_find_completion_wordrl_menu_completecrl_complete_internalnrl_insert_completionsrl_possible_completionsrl_completerl_completion_entry_functionrl_ignore_some_completions_functionrl_attempted_completion_functionrl_basic_word_break_characters.rl_completer_word_break_characters@rl_completion_word_break_hookXrl_completer_quote_charactersjrl_basic_quote_characters|rl_filename_quote_charactersrl_special_prefixesrl_directory_completion_hookrl_directory_rewrite_hookrl_completion_display_matches_hookrl_filename_completion_desiredrl_filename_quoting_desiredrl_filename_quoting_function rl_filename_dequoting_function9rl_char_is_quoted_pRrl_attempted_completion_overdrl_completion_typevrl_completion_query_itemsrl_completion_append_characterrl_completion_suppress_appendrl_completion_quote_characterrl_completion_found_quoterl_completion_suppress_quoterl_completion_mark_symlink_dirsrl_ignore_completion_duplicates rl_inhibit_completionrl_complete_with_tilde_expansion1rl_visible_statsP_rl_complete_show_allb_rl_complete_show_unmodifiedt_rl_complete_mark_directories_rl_complete_mark_symlink_dirs_rl_print_completions_horizontally_rl_completion_case_fold_rl_match_hidden_files_rl_page_completions9)#"/rl_bind_key|rl_bind_key_in_maprl_unbind_key rl_unbind_key_in_mapDrl_unbind_function_in_maprl_function_of_keyseq rl_get_keymap_name= rl_set_keymapd rl_get_keymap| rl_set_keymap_from_edit_mode rl_get_keymap_name_from_edit_mode rl_get_keymap_by_name rl_variable_dumpercrl_dump_variablesrl_variable_valuebrl_macro_dumperrl_dump_macrosrl_untranslate_keyseqrl_list_funmap_namesrl_invoking_keyseqs_in_map)rl_invoking_keyseqsrl_variable_bindrl_named_functionrl_function_dumperrl_dump_functionsrl_unbind_command_in_map7rl_translate_keyseqnrl_generic_bind%rl_macro_bindrl_set_keyrl_bind_keyseq_in_map)rl_bind_keyseq_if_unbound_in_maprl_bind_keyseq_if_unboundrl_bind_key_if_unboundrl_bind_key_if_unbound_in_mapxrl_bind_keyseqrl_parse_and_bindrl_read_init_file rl_re_read_init_fileUrl_add_defun rl_readline_name rl_binding_keymapU!_rl_possible_control_prefixesx!_rl_possible_meta_prefixesEy _rl_scxt_dispose_rl_isearch_dispatchp_rl_search_getchar_rl_isearch_callback_rl_scxt_alloc rl_forward_search_historyF rl_reverse_search_history9 _rl_isearch_terminatorsK _rl_iscxtTPrl_on_new_linerl_forced_update_display rl_reset_line_state$rl_save_prompt:_rl_current_display_line_rl_clear_screen_rl_clear_to_eol_rl_erase_entire_line_rl_move_vert^_rl_clean_up_for_exitt_rl_make_prompt_for_search_rl_strip_prompt _rl_erase_at_end_of_line9 _rl_move_cursor_relative _rl_update_final rl_restore_prompt- _rl_redisplay_after_sigwinchs rl_clear_message rl_expand_prompt rl_message rl_character_leng rl_show_char rl_on_new_line_with_promptjrl_redisplay$rl_redisplay_functionVrl_display_fixedh_rl_vis_botlinz_rl_last_c_pos_rl_suppress_redisplay_rl_want_redisplayrl_display_prompt_rl_last_v_pos3g drl_free_line_staterl_clear_signalsrl_cleanup_after_signalrl_set_signals!rl_reset_after_signal rl_catch_signals rl_catch_sigwinchq _rl_digit_pE_rl_digit_valuep_rl_savestring_rl_uppercase_p_rl_pure_alphabetic_rl_lowercase_p$_rl_to_upperi_rl_to_lower_rl_qsort_string_compare_rl_strindexprl_copy_textrl_tilde_expandHrl_extend_line_bufferqrl_tty_status_rl_abort_internalrl_abort_rl_walphabetic5rl_alphabetic_rl_allow_pathname_alphabetic_charsz ]rl_set_retained_killsrl_yank_last_argrl_yank_nth_argrl_yank5rl_yank_poprl_copy_forward_wordrl_copy_backward_word!rl_copy_region_to_kill^rl_kill_textrl_unix_line_discardrl_unix_filename_rubout>rl_unix_word_ruboutrl_kill_full_linerl_kill_word rl_backward_kill_word^ rl_kill_region rl_kill_line rl_backward_kill_line6+Ch_rl_fix_last_undo_of_typerl_do_undo rl_undo_commandJrl_revert_linerl_free_undo_list rl_add_undorl_end_undo_grouprl_begin_undo_grouprl_modifying _rl_copy_undo_entryG_rl_copy_undo_listrl_undo_list_rl_doing_an_undo0_rl_undo_group_levelnx_rl_push_executing_macro;_rl_with_macro_inputdrl_push_macro_inputrl_call_last_kbd_macrorl_end_kbd_macrorl_start_kbd_macroA_rl_kill_kbd_macroV_rl_pop_executing_macro{_rl_next_macro_key_rl_add_macro_charXrl_executing_macrof ~_rl_any_typein_rl_unget_char_rl_pushed_input_availablerl_set_keyboard_input_timeoutTrl_stuff_charrl_execute_nextrl_clear_pending_inputrl_getc_rl_input_available_rl_input_queuedrl_read_keye_rl_read_mbstring_rl_read_mbchara _rl_insert_typeinr rl_event_hook rl_getc_function $_rl_callback_data_disposeK_rl_callback_data_allocrl_callback_handler_removerl_callback_read_charrl_callback_handler_install_rl_callback_func _rl_callback_dataz rl_linefuncD1. &rl_get_screen_size[_rl_set_cursor_rl_control_keypad_rl_enable_meta_keyrl_dingrl_crlf_rl_backspaceB_rl_output_character_functionm_rl_output_some_charsrl_get_termcap_rl_get_screen_size_rl_init_terminal_io^rl_reset_terminal_rl_set_screen_sizerl_set_screen_sizerl_resize_terminalrl_reset_screen_sizeD rl_prefer_env_winsize _rl_enable_keypad _rl_enable_meta _rl_term_clreol _rl_term_clrpag _rl_term_im _rl_term_ic _rl_term_ei _rl_term_DC1 _rl_term_upC _rl_term_dcU _rl_term_crg _rl_term_ICy _rl_term_forward_char _rl_screenheight _rl_screenwidth _rl_screenchars _rl_terminal_can_insert _rl_term_autowrap _rl_term_backspace _rl_term_goto _rl_term_pc _rl_term_ip__rl_fix_pointrl_beg_of_line#rl_end_of_line^rl_do_lowercase_version_rl_set_mark_at_posrl_set_markrl_exchange_point_and_markZrl_forward_byterl_backward_byte_rl_char_search_internalrl_backward_char_search1rl_char_searchrl_forward_charrl_backward_char< rl_backwardy rl_forward rl_forward_word rl_backward_word rl_capitalize_word rl_downcase_word rl_upcase_word> rl_newline} rl_arrow_keys rl_refresh_line* rl_clear_screeni rl_replace_line rl_delete_textrl_delete_horizontal_space__rl_rubout_charrl_deleterl_delete_or_show_completionsZrl_rubout_or_deleterl_insert_textrl_transpose_chars]rl_transpose_words rl_insert_commentd_rl_insert_char_rl_overwrite_ruboutrl_rubout)rl_tab_insertrl_quoted_insert_rl_overwrite_char~rl_insert_rl_replace_text$#a_rl_init_eightbit Z_rl_reset_argument_rl_set_insert_moderl_emacs_editing_moderl_overwrite_mode2rl_vi_editing_modeqrl_replace_from_historyrl_maybe_save_linerl_maybe_replace_line_rl_free_history_entry_rl_free_saved_history_line9rl_maybe_unsave_lineSrl_get_next_historyrl_get_previous_historyrl_beginning_of_history<rl_end_of_history{_rl_start_using_historyrl_discard_argument_rl_arg_overflow_rl_arg_getchar_rl_arg_dispatch>_rl_arg_callback_rl_arg_initrl_universal_argument rl_digit_argument5 _rl_history_preserve_pointG _rl_history_saved_pointY _rl_argcxty _rl_saved_line_for_historyq history_set_history_stateusing_historywhere_historyhistory_set_pos3history_listJcurrent_historyaprevious_historyxnext_historyhistory_getreplace_history_dataCremove_historyunstifle_historyhistory_is_stifledhistory_get_history_statehistory_total_bytes#replace_history_entryalloc_history_entrycopy_history_entry free_history_entry[clear_historystifle_historyadd_history_timeAadd_historyhistory_get_time~ history_base history_length history_max_entries max_input_history history_offset3 history_tokenizerhistory_arg_extractKget_history_event history_expandjhistory_expansion_char|history_subst_charhistory_word_delimitershistory_comment_charhistory_no_expand_charshistory_quotes_inhibit_expansionhistory_inhibit_expansion_function$ ,write_historyYappend_historyhistory_truncate_fileread_history_rangeread_history history_write_timestampsuhistory_search_prefix(history_searchbhistory_search_poshistory_search_delimiter_chars_rl_is_mbchar_matched_rl_char_value_rl_find_prev_mbchar_rl_adjust_point_rl_find_next_mbcharO_rl_get_char_len_rl_compare_charsurl_byte_orientedU tilde_expand_word.tilde_expandtilde_expansion_preexpansion_hooktilde_expansion_failure_hooktilde_additional_prefixestilde_additional_suffixes{&Lrl_set_paren_blink_timeoutrl_insert_close~_rl_enable_paren_matching9rl_blink_matching_parenortgetflagZtputstgetstrqtgetent$tgetnumospeedtputs_baud_ratePC1ydtgototparam}BCUPq glob_pattern_pglob_vector glob_filename- glob_error_return? noglob_dot_filenamesQ glob_ignore_case(*wcsmatchstrmatchI+L internal_wstrmatchinternal_strmatch1xstrmatch.?xdupmbstowcsxmbsrtowcsF!CJ (`10g-^k ###5# %#<#{##@ # #$ #( #,"#0$#4Y& #8 * #<,#@0#D& 13#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN #lP#pW int    M 8A9HZ 1, Z R O  RHOC{ Rp M 0 x 0# ,@ w zt {# |#  Ah %q J &e# : '# +# -# .# { /p# t 0{#  1e# A 2#( M 6#0 V 8#8 a =#@  FK#H  GK#P  HK#X X#`   Ap# n #  #~0 w ' On 3f 4# 5 5# a 6p# 7{#  8# e 9# @ :#J7 '  V   # ?z$ )# * # +@# 1 - ? f  Q   ! k    XA 0  4  e  a &d6 oe# _kf # g n^jj Bpkj# olp#A6 mA{ | j}p~  Bp # 5  # _k # -# # # For uX U If 0 O    g   z  m _k # $ # p# ` # m #cX _k # $ # op# {*q #  \  _k #-n #m #^   _k # -n #0 # #  X00 k #  # m # 5 #  N _k) #$* #W+` #F--# 6 E _k2 #$3 #4p#5 # m6#  k< #= # 5g _k # $ # p# ` # m # i  _k #$ #exp` #m ^ _k  #$! #{S" #op#p# Qg$ #$ # gz _k # $ # %` # -n` # ` # m #   _kA #B #  {S# _k # $ # F-# ##   #Z BpZ # j` # m # _k #  vf  f ^t Bpu #w z o{# | #}       `  y#W h {S # x! # O ! # ("#s"ind& # '# Bp(# (#hV##" Bp##key$# )%# &# ' # (1 *Y `+Y# , # s - #_."<! "# 7# # _k$ #up%# 9&# 8'#pe0(p?a?a R# S# jT# U# ?X# Ҭ[ # \ #qqqL @qq twl]xj5uidk# `k#gidl# l# m# dn# iFo# w/ 0# V15# _k2 # 3#  4# `5# "  # %|  [G HIgK %yM Or {SP# Q# R# dCSr# \ Tx#%U#  # {S # R q#  #     l1(D% 2%UEDV! >"#ȃ\" ȃ#dK H!J$ L#. ` H؄!_ $ a% ؄܄]'&s F%d܄4]N&sc Y' #4w((&fp!D  )i $I*s*t#+Ć,,+Ć,,h   %(*(x6I , U(#xĈa!+-fnT. Ĉ !W$m *nw k*nb *wl` *tl` $j ` . |8F!c m T.W; |k! :*fd< *e< X, <  j=X$J=*t= K>$ ?  -sb@~$ BI$ Bg$:B$pC$q C,C/00'G!. ܐ@! k!5 !- ! -i T$` 1v )uw2"3< 1"  5 - ,C , )i ,/ 4,,1   D 5  -  ,C  ,!   ,  ,  )i  , ,/  3e k5opt 2] 3%)i 3O,#{P 3~ ,'  , 6ҋJ ܐ` ?!G 8!H  &envH $ *iK D $mL  $L  $N  $ Pt $CQt! $9QtM 7 w889  :p7!;/ 7<'0f0Z0N8u48 9788h?}7i89<8$!w$@ ̑@  @' @  @ @ @ @ @  @ @R      )0   { AAA AB 'Bm ABɿA+< CAןB D)B BV B B B&  B  B pA, A- A. A0 A 0 A2 A9 A AYB AF;;D  ȑA!fW~A4" A=_ A` Aa A>b A c Ae AfAsfA[gB8 k BmwB B B? B) BB@)Bz 'B  B L)B H)B B[ Bt    Bܥ B 'B 'Bv 'D 'D  'D5'D   C `ȫ/10g-^k #y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y& #8 * #<,Z#@0#D& 13#F 2#GD6#H?l#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN #lP#pW int    M 8A eR O   x # ,    Ap# n #  #0  &'}J7 '  V   # ?z $ )}#  * # +# 1  l ? f  Q   ! k    X A0  4  e  a & d o ey# _k f # gn^ j* Bp k*# o l0# m {` | j }0 ~A  Bp # 5 # _k #  #  `# y#k k zFor u U XIf  O ?   '  g   :  k m  _k # $ #  0#  # m #zc  _k # $ # o 0# {* 1 # \ X_k  #-n  #m  #   _k # -n #0  #  # ^X0  k #  # m # 5 # N ?_k ) #$ * #W + #F- -# E _k 2 #$ 3 # 40# 5 # m 6y#E k < # = #5 ' _k # $ #  0#  # m #i g _k  #$  #exp  #- ^ _k  #$ ! #{S " #op #0# Qg $ # $ #m g : _k # $ # % # -n #  # m #   k _k A # B #@  {S l# _k # $ # F- #  # q  #  Bp  # j # m # _k #  6f &  A R   d   7  " Bp # #key $y# ) %w#  &#  ' #o  (o 1 * ` + #  , # s - #   .  ? ? Ry# Sy# jTy# U # ?X # Ҭ[ # \ #  2 L @   yd t'  l]2  !X "R  #B %L |  [Gv  Hv IygK %yML O {SP! # Qy# R| # dCS # \ T #  %U X  ] K`3!i  "L#pwdy$p x3%r ^&y'3x($D)@q$~ x* * *j  *' LX+ $,@ ȫ2q&%A ,;Bqp-.*mK ] /// /0 E /#  # u Bp u # j { # m * # _k `# 0 ]f 0  D % ^ t Bp u #  z o {#  |`# } ` ``` {   0 J W  {S 1 # x !& # O !& # ( " #s " ind && #  '# Bp ( #  ( # V #J ?_ ?_ R# S# jT# U # ?X # Ҭ[`# \`#o o o  L @ o o &  t u l]  !xj>uidk# `k#gidl # l # m# dn# iFo#)4 `# ;# `# v`# `# )`# `# `#  # #$ 0#( `#, `#0 *>"  # %S|  [V6 7`# 8# 9# H:# ;`# <#=SG HIgK`%yM OI {SP(# Q# R# dCSI# \ TO#%U   # #`# _&`#o  # # _k4# w/: 0# V1# _k2`# 3:#  4# `5#@tm,  `#  `#  `# < `#  `#  `#  `# p `#  `#  #$  #('I o(W v)` n^*{ +* ,- /-3 w. /! cBpd#!feU#$f`#h#UMjU!.Bp.#`##4# `#`#`#"\~#__sZ#__nZ$?Z~r%A`ȫЫ]%qЫ]&x`'`D](c`' `Dx]-) *c '`x]W(c`+`Ԭ],{S(-sR.Ԭ]/ts;P0\BT]/cA`P1G! `Tح]'`ح]#,-`+ 0]N2i`1%_`0d].Wfd](xe`Z3yUm-tVT-t1VU:4 5Lj]4M6<(ps< -v T7+;\+m*ret;7<\|V(ps<u2v 7`|,-i`T3dx-msgeT)f`/6c`xB(get[Im,\O,{S](,^8_6\,zfZ,[.9]6'@L,%w,&9(6v@?): {(tok`2t#;@mзx3 з@2i!`q>e>Y?2jJ`*3H(ss,Zw`(ap49 @ x$w*msgyAy:*msg;*t;9<`*i<`79 `@t(msg B >?C B?DDDC47@,)({ ^)?` E4 14F13I6 'EVv (:o `xj'(ep ',: `'9 `<ױ `X2c `')FK () 9()X `b(Aws$~v`9Qz`*cz`9Kz`9z`<xT<y`PA`#c`7D( ,~`(BX>?xC (C,(D6CB)Js`l>6`0)2 *r`@P M 9V @Xr $*XW`*cY`A< ` #c `9W `9 `9: *wd WAd `"$*X `9 W9m `9 `9 `9C `95 `9+ `*cd `9j  `9 `9FK 9 9X `9 `9 0G9G!G0.K!9: `K!*iV`L9V9VK "*ig`L9g9gL*b"KP"99L9"9h `L99L9"9h `"A `"#t #i `*c *r `A `##t #i `*c *c1 *r `A=e#$d;*wlf{ *rlf{ *tokg`9zg`9g`9ng`9g`9(h*rethAU `#$T L9x 9x L9x "9h x `Az`*$$9 *ap 4M'Z$#s*l`*r: ``0O)', `{))*X `)) `*)j  `+G =  '> ?@C -C -C .D!D !D!D$!C0!3D;!CG!3CS!5C_!P8Ck!9Cw!9C!2:N!N! N!=#8 M}%>#Hh %C!R:="  %>"O";? C"<C#K=D #="  %>"O">? C"U?D"H &C!?H %&C!?=# \}&>$? C$AC$BB*$  O;$B? CE$CDO$H8 &C"DI@DQ"D]"I@Dj"Dv"B#P  >*#? D6#CA#DCL#ECX#-FCd#lFCp#FD|#C#BGD#PM d D'>[ IlCg G=2  d'? C@ GBr h T > ? C GD C :HC rH&+ `0H:w+9 (H(2op: WH)!; (:I); (I); (J2tok< `#J)< `J)V= gKI<\9 9 I<\9 "9h  ` :1 (K(-l (T2r (K: (K(-l (T2r ( L1 (]: * 0 L>)9q (6pe0$KL),dwL,dL)lfL-psg6$H L)? 96yH  M*,x`1M)zOM7 { ` mM*(s M,_k `M, M2wl { N2tok`=N)g`Nm` \t$\( W5 1\G5 z5 1\j5\)`,\`8\``, C # 8)<g-^k###5# %#<#{##@ # #$ #( #,"s#0$y#4Y&#8 *#<,#@0#D& 1(#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN#lP#pW int   M 869=O 1! O R D!O  RHDCp Rew  z7  {# |# 6h %/ J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#`  s Aps# n y# #<% 5 ' 1#9#Q k /#  B# #!1" XJ7 '  V  &d oe# _kf# gX"txj)uidk# `k#gidl# l# m# dn# iFo#+``BK#C8))]onBj[ \)*}[s[[ret][neg^\#**] 6\s"*T+]Lj\_k\s T++]K\ Q iR cS"+ ,]\!#q ,-\"ir#]#, /-l.]C$ngp/]"i]%h!/#"l.. ^$gid6^"ij^&Y"./}^% # #/0^$ngp/^"i^%f#' !# (s)r#"N01$_ $sLC_"Ma_%!OV)rO retPP*$1X1Z+ ,$1X1- #5!'12_ $s%__k&_&/_"r(`"ret)8`)l*. 2\3V`^ = u`/j `#!\304` a/sa"ia0Ԅ)len0#!s044a ra/"tb)lu#!-4 5 bc ,?bs#,sb0j .#d\ 55b  [b"ret]c#"F55c E8c"pGlc#55c c#|#5,6cf $fnc sbB*456+S+G# ,6X6d $fn&d##iX6|6Dd $fdhod#!J|66d $fdId/_kKd0#K#!67d $fdd\#e 9e/^!me/:"e%k\& y7(8e / z!f)tty{(88?fjfscf#L8:fpf_kg"c 9g/# Wg/Q gZ ::gogN"g"7_!>#:H;h[Fhj [dh17h2ept3::+++74?"rH;;hnph"q-i2ssS2psV # ;<Kis#wi#i#`i"`j st1B st2B~54\<p<[+S+G64 +S+G 7%ls%!!%%J!%< %f%f%#i8y8y8 y L98DA8gr8& Z8 r8u!1)8"<8j"A8 2838t 58"6: =hyC& <K!g-^kU###5# %#<#{##@ # #$ #( #,"#0$"#4Y&U#8 *U#<,#@0r#D& 1#F 2(#GD68#H?#P: H#XA I#\H J#`O K#dV L#hqNU#lP>#pW RTX)& &  OU PU# Y# int%Z0'e\)  M 8 R )  Ap# n "# U#%)8 &)N &'J7 '  V  / ? f  Q   ! k    XA0  4  e  a &d oe# _kfU# gn^j Bpk# ol# m{# |Uj}~ Bp# 5 U# _kU# # ## #. ./ o# #7qForuUOIfO6  ^  1 b m _kU# $U# # " # m #qc _kU# $U# o# {*3 # \ O_kU#-n #m #  _kU# -n #0 # # UX0 kU#  # m # 5U# N6_k)U#$*U#W+" #F--# E_k2U#$3U#4#5 # m6#<k<U#= #5 _kU# $U# # " # m #i ^ _kU#$U#exp" #$ ^ _k U#$!U#{S"U#op## Qg$ #$ #d g1 _kU# $U# %" # -n" # " # m #  b _kAU#B #7  {S/# _kU# $U# F-# # h  %Ţ# Bp # j" # m # _kU#  f  ( $%q% ,%U$ %$ D%d J%.%7<&>&C7 ^ t Bp u #  N  W D {S # x ! # O ! # ( " #s " ind & #  '# Bp ( #  ( #D V #  ?  ?  R#  S# j T#  U\ # ? Xb # Ҭ [U#  \U#$ $ $  L @5 $ O $   t * l ] h A% 7 ) 8#cs 9U#nc :U#$ ;y \ __sZy__nZ?Z g%$ <$=1j& \j$ $=x=zj]  ] $ x==j%j! j~ %=>j{SUk"op2kQg Pk nk d% >X>kY"exp" k  Yr #z3 X>>kjx" kmy l# {3 T$% >>0l%{S/[l%]yl&  % >?l. l . '% ?8?l&/l-n mm /m f (% 8?H?]-n Mmm km( & H?X?]-n mm mJ' X??mi-n m0 n n iZ )&k ??>nohin{*i3 njUn! ln9 ;&^ ?@n] o _ )_$ @\@)o%{S/Ho%fo%" o%m o*U& ׇD $' \@@o%o%" p%m 'p%UEp$e& @@XpA%p%" p%m p%Up$$ @@p%$ q% $ -q%5UKq& Ɨ $9 @Aiq7 qv&7 q58Uq+t: r+t1: -r,t2: $U%" ABKr_%ovr%&" r- " r& BBr./ h r/TB|B+rs$&QBBXs- Rs0%JB Cs$ CCss sUt$U:t! Xt! s vt q O  &CXEtUttr$#u! /u+wyu 9U+lfdNu1%.XEGu -u '/U &/U!+'0u!%08v!P0wv!#1Uv!3%1Uv!V&1Uv2Z'F3 !$_w,len`U$:$qGHFw4woqw%pyw5irUU6sY6ZtgX3 6&gP-&w7 8 8 8 $&]HIw%\yw6 ^U$w%I Ix%y2x& )6'" IlIPx74s{x j " +wdxh' lIKx%'" xm yUy! =y#%" Z#-n" W!" fy+sy+ty Ԅ#%UVO $J$KKz9%UCz6$9v)I &9"9"9 "9 .U9>8U99U:N&< :%= VC( Kg%g-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,`#@0#D& 19#F 2#GD6#H?r#P: H}#XA I}#\H J}#`O K}#dV L#hqN#lP#p(+(W int &   M 8G kR U      Ap# n # #  %   '(PWJ7 '  V   ? f  Q   ! k    XA70  4  e  a &d` oe# _kf# g7n^j Bpk# ol# k ` mk{ |j}~6 Bp6# 5 # _k# W# # #   <For7uUIfZO8 =   m7 _k# $# ݚ# ފ # m9 # c _k# $# o՚# {*֛ # =\ _k#-n9 #m9 #   _k# -n9 #09 #9 # X0Z k# 9 # m9 # 5# N_k)#$*#W+ #F--G# `E_k2#$3#4#59 # m6# 8k<#=9 #  5 _k# $# #  # m9 # >i _k#$#exp # ^= _k #$!#{S"#op## Qg$= #$= # g _k# $# % # -n #  # m9 # C   _kA#B9 #  . {S# _k# $# F-G# M#  . #ʄ Bp˄ # j̊ # m9 # _k# ? f ?  $=%%C '>,%$ D%J%.`%7&> "  t ]; -+2KKVz (/ uzWt0z),1 zw3 T ) .+=KL] (; zWt<z&+LL] ( zWtz B(L4L]'4LL{X T;{!pLL"newY{{)LNl{ ^O {"s {#>+ ^$|#O( L$("|$6*P|%c#l     (NN])N,Py|U hU |  &#*,PXP| hU |&'XPP| [+ }(@PP] .&? 0}  &*PPC}  ' b}  &&)PQ}<j&<}  *xQQ}z",w}"iy~kQQ/~jN~=)dQTl~>cG~$'ea$5 e$&(e$f' %"x!`TT"x((,TVFF-+Ge#'-GV$*-G$(-G؃&'V@V&  (+)j&<(+)m'  ({( ) '  ()O9).&N (p*ZT){*Y (g)mo)&lo  (\*t)&so(/,)O'  (*)8*)9 *V(G  ())@&  ++@V](g,9 S-WWO.q/h./.-W,X.,09W XS.G-T,X*`de ( ' "w >"tQ"xNj&*eeK ' &)eDf.vj&<Y&O){DfDgwyynqzҌU*z$*|:' Dggc90 $ :*{ggD,z9 ;(7,;*8l;+l0;+m4; +n8;'r< c;/(u@#)r#*s<<< <)5= ,g =)h$=*i( C, gTl+ int  M R/ ? f  Q   ! k    XA]0  4  e  a &d oew# _kf6# g] n^j Bpk# ol# m { |6 j} ~ \ Bp\# 5 6# _k6# }# # w# b  For] u UIf5  O - ^   c   m] _k6# $6# # ޻# m_#  c _k6# $6# o# {*# c \ _k6#-n_#m_# 5 _k6# -n_#0_#_#  X0 k6# _# m_# 56# ; N_k)6#$*6#W+#F--m#  E-_k26#$36#4#5_# m6w# ^k<6#=_#3 5 _k6# $6# # # m_#d i _k6#$6#exp# ^c_k 6#$!6#{S"6#op## Qg$c#$c# g _k6# $6# %# -n# # m_#i _kA6#B_# T {S# _k6# $6# F-m# s#  T %; #ʵ Bp˵# j̻# m_# _k6# p f p $c %  %i,%%D%J%.%7t A% 7k )8u#cs96#nc:6# $;6y,g0hwg hmzpwJe,Kmcnn,0hh" w`hhmzpwҎe,Kmcnn,)h8iW ((m<t*mk,8iip (tmzp wϏe, Kmcn n,i(j/ h N @,&(jll %_ jj, c jjG c Ӑ jj^ c jku c k,k c! ,kLk c'  Lk|k cE- - |kk c43 Kkkca9 itbpbe#,l<9-tti,2tt&(7,0tuŗ &|3 &/ ,.u v,4)fd K'3   vx^&w '&W z Ә&_k &E r*v6 [+j  +1 ڙ2O2 ,2U xHx(argT %.varV P'-=HxyCh(lz n(okpz.newz V+5=1r '(0  y4|&h +j  L*+ X+. + ʛ2u3 +) +) H=zz)oe f 4|54||^& )ret͜4gV |T}&U) !*n3WT*j X U'0!  T}$?&& j&{S +4" *G." [ 0 6!(z !/ !H!4 2S1 2F5 1len 2c0=1lz 2J/1t>>>?S3@!(z !/ !S1 !F5 1ind 1row 2W1 1pos 2ݡ 20 295 2W7 0/ @len @ind !(z 1lz 1i ?*!8/ @to '5 $ĝ& '+4z +(z R1v +` !+04!+f1!A+q" +/" d+12" +6" ڡ9 0b6A656)68h:M;Y;e:qO;};:{A6A6A6B668 ;;:ۢ:%:N;;';3AHx6B9@h6j6^BR8;v:]C6 'S.R hɤT&j&QT+4Sz +(Sz 21vT+` UP+qV p*6V p 02b  !_) !d6` !|3` !/` !q0a2c 2-c2/c 23c 21c 2/c 1cmdd) 2k3e'P0 hԐ& &) ڥ&d6 &|3 X&/ v&q01rp7)tc) +m) ܦ*1 Z+/ CZ6666x6l8;DP:O:b;;;:u0y/  !m' 25=2.- 2G. 2}1 22  0- %!!.&%!2(z 24z 1esz 2{* 2o2w2q 2 21 26 Er2 0[4  J!!& 0,  i!!& 06^  !!O'] !24_ 26_  0R5~   "!i%} "2.- 26 2q 25 =1new z 1exp  0.&  J"!$% 2q' 26' 0- "!!V) 1var43 ԐR%&) ʧ&d6 &|3 &/ &q0+/ ++ G+1 g2D3 +p17+27+%-(k+6(ǬF#+2/A& 0#B8 c8`:D :P ;\ :h ~:t ®A"H#B%"8;1";="A!@?J$B!/8`:!c:!;!:!:!8:"wA $B 8: : J: ~: : : F; ; ;!:!G!<Ai!$B{!ղ8;!:!A+! %B=!iAJ"N;%Bh"|B\"Ƴ8@:t"9J!xB\!9'6f  L&(vara x&Wb z &_kc ʴ&q0d  H#/e &Ee (+3g `+j g )tch ) 1fch ) +5h ) +Sei i+di ɶ+yei )* k h)nfvk + k +:k ۷+pl +q l d+l +/n &+`1o )to ʸ*0p  ,1Q '&WJ z &F-K 7=&wL '[(varM z&|3N &/N &#/N ֹ&q0O H_kP +j R )rR 4+6R G?. (!W z 1w z 1b (-07e  W(!F-c 7!|3d !/d !#/d 1rf 0+.  (!W z !w '@var !F- 7!q0 !_k 2j  21 720 '05  (!j  1r ?/!)!Wz !F-7!-!|3 !/ !#/ !q0!0  2""2"2"21# 1pid$E"4I26M '6  {Y,&& Y,&|3 &/ \&#/ &q0 ڻ+W z +3 z Լ+- + 2 R2  25 +j  +2 ؽ+)/ 42H6 +7 x+w '+8 J- ܮA'. ++6'8:'I:'}A( +Ba)6U)6I)6=)61)6%)B)6 )8(:m)K:y):) :);)G)$8:)^A (; +6@(64(6((B(|8:L(AW(P ;,B(6(B(96(6u(6i(8x;(:(L;(9( 6(8;( 4160  4,(var. &W/ z .ret1 U*n32 T';2 4-&) (&d6 r&|3 &/ &q0+3 T+5 t25 *1 Z2+ )ois +-) ?+7z.@fp!0@rs@rsf @us@usf @ss@ssf @cpu 2q6 1lng 1len 1str1s1ts-1sum24 22 26 '58 0&5) &d66 &|36 !&/6 ?&q07].rv9 |229 2/9 .rs:p.us:l.ss:h.rsf; d.usf; `.ssf; \.cpu< [+0=}*.@* @.sys@*u5A*:0A.dtzCA*.E~*.E}*>3E}*83E|9-6-B-B- B-;B-jB-B-6-B-8:. :._:.:(.;4.D>.~;I.;U.:a.:m.|K. K6) K@7 K1 K.  31 *@0E1 #1*2o */o * 0o *, LbLbL bL,L ,Mg,)LB1Lf LZ2h Lv-i L ,jLjL.kLl'L0l'LmLvmLn M8  +M[$+M;4+OSBH0+Mc )M 3 +M )MV/ )M47M47M (+M1 Mb-+Mi0UBC[>  ;g-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,#@0#D& 1-#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN#lP#pW int   M 8;9BT 1& T R I3    RHI Cu Rj3d Mw zb {# |# r  ;h %j J &_# : '# +# -# .# { /j# t 0u#  1_# A 2#( M 6#0 V 8#8 a =#@  F9#H  G9#P  H9#X X#`  Ap# n # # q %   j  '  SJ7 '  V    ? f  Q   ! k    X A30  4  e  a & d\ o e# _k f# g3n^ j Bp k# o l# g \ mg { |j } ~ 2 Bp 2# 5 # _k #  S#  # #   8 For 3u ~U If  V O    4    9   m 3 _k # $ #  ݖ#  ކ # m 5 # c ~ _k # $ # o Ֆ# {* ֗ # 9\ _k #-n 5 #m 5 #   _k # -n 5 #0 5 # 5 # X0 V k #  5 # m 5 # 5 #  N _k )#$ *#W + #F- -C# \ E  _k 2#$ 3# 4# 55 # m 6#   4 k <# =5 #  5 _k # $ #  #  # m 5 # : i _k #$ #exp  #  ^ 9 _k #$ !#{S "#op ## Qg $9 # $9 #  g _k # $ # % # -n #  # m 5 # ?   _k A# B5 #   * {S # _k # $ # F- C#  I# * # ʀ Bp ˀ # j ̆ # m 5 # _k # ; f ;  % 7     |B կ 5; ֻ   r  W a {S  # x ! # O ! # ( " #s " ind & #  '# Bp ( #  ( # a V # 7 )a  " Bp##key$# )%# &# '#   ( 1 *c `+c# ,# s -# i !.,<! "# 7## _k$#up%# 9&# 8'# z o0(z?k?k R# S# jT# U# ?X# Ҭ[# \#{{{ L @{{  t  l] 9 _ (`# Ma# /b#  AcE#3D n( #M#/#@3xjuidk# `k#gidl # l # m# dn# iFo#  w;OB _kP# _CQX# s@S^# DV^# REW#RR  B n7Y9#V#  X]<#] < !!Q"ind" RS<-]: <,#B]`!7&P^Br] <qt= ȿ]$var 8 ȿ]$var P? ,]$var ? ,h]<$var "D h]h$var @R:R ]$varQ S%8=f$var&pU'A] (WF]^$sv1^$sv2^)r*++ ohE 0] +;  0; ,j  !*+ + 'B04] 4%?4GU$varr  : ,Dr%B$var 3 : Q,Dry'1D?] >-B-( ,'.A"(,]0 !.@}/i/r0++-9, ')iE10L2BX*3N4Xk5R< 6>@@64@6f;&4'; 4@]e A  - <B @|3$vcA R -@ |p wE )v &t T-&9 `)ret 5wE T-E= `@;&vc T%U8_  A,y`i7=W ] V 7F),] (  78 ,<] 8E<p 2 AP&vcT)vy8F  A)var+q87;L] -BKL.# JM-B$`~ ,@5 T9$:-:$L /v-;]L \0/v^-@GC  Fn&svHP- <U /v6:-E  d 5wE T)ret 3;|A g E   <6B  ]-Df (n,kCh,AFh5&CiU,Fi )cej ))ikrG-g>M( (L ,kCO,AFO5&CPX,FP/)lQ B)iR U)tSm-:P8 &vP%E rPr s  +9 r  =: 9 r>var _k /i 0+ + .? r9 r>n ;>d   ^:` 1 8a P 9b r _kc &ie l5f iX/rg &varh Y9xu :::* ?T9P" 2: 8 CH   VG ,9I r3)retJ Q8A/  o V- $vc. )v0 ,91 r)ret2 ,s 3 $8:/  tB - a _k. &vc0 T8kB^ tD [  _k\  x7] )vc_  -?$5  ` ;~ x777 $4] _k  > %KD4! !+@?1?S! <.^ /| :0 @BT!$var)pA;<T%^D@<! [ 8y5U/elti-?} @h&" W| 8J= hDt",9 r)ret )vc F%'? D`o" 8 5( TB@ `l]B'< lt]%7 t# 8 5( TBMA ]B= ]BE ]B> ]B ]8;`  # q^  C_ )ia ;518b Y-8 ToJ$ =  ^=   ,i '< Th]s$ ` ;@ h0$ >~ [ C  @9 /i 8E@!  F%  ,*" ,Z# J,ZC$ s,A$ ,Q$ 8 E( $% ' &elt) iT+:* -=$%$var# = ]% ) </var 8J8C @Or& A z$vcB &eltD iV+ @P]&  8 8 P.&  M&elt iT+8 .C 5'  +) +C /p 8pDgt`' of,h,i+ i5iX)varj,k99&h2'L2&j*3'4'4*'-EIt]( G H5JU/eltKi&cmdL5 T886( a 5 5UC)elt!i8;, ) 5T+W-rFg,)$pse Bf8)vhW)ai)aej )ik/tl5l)L )  '>])$sO&vt%D:LbL* 6 97 _98 D;9)v;7F2Lx]y*$var1.87xL(+$var w   _k!,q`,Y,rr,ױr,.-,:[8Dy+$var  (@)t%7L&, HQ Io 8J 8K (@K,:M/5NT; : TcY, ) )var )v ;9s T, )r )vart 1)vt O;p<` b, )_ &vara U)va 58b T#7 ])- ) /var .@C `-A B /varD 8rJ-  0 _kN/v)vclD)-(:G-:;-*4S--$B |-.  , 8aA|<.$lhs"$rhs@)v^,:,B8):<x.$var $val r5JB.b)p/ / -2CbxB^/ am ݡa&valc)d)vc8!>n/ m,@o;5?oU)vcpd5~DqZ5MFrY8:@#0 &varT,W8A^@p0 ] ]')v_E85>Ec0 @D/varF->X0 W)vY-69Al01 @')ttB:9E:-ElXk1 , -=1 5 V&valT5~<u|->82 , F&numrp,UCd-<UF2 T79P]q2$vOEB892)rv Fq2,t%9 3$varG)rve&pU%>\ L3$var[+8].&p^T%OBR3 <O P :Q ,-<$D3$varo-9$4$var )t-?((Q4 (S/i&varT-V)(q|4$var-<}4 (|/i~)var8-;PV 55A)l5T,7-CPb5,7,: ,D?57U-m:|:5 e57F5k,C,;r,7 5 GbFG|=C66+77H==:O56+7P.q>o6+pIq6+B}/len~0+V/s=.?^6+7_=a8C6/vvD/avE/sF/dFb/bF)==)7+3*7/b*/v+ '7  ==@7/v.9:l]7/vm.Cz7/v-B 9$env 6 Du,,@,D?/c,B+*+f=,7F5`F6J568* 3G6Kx84r63~6*4X63d6J6 8*@46J6`8*46F4646?6?6AJ6("9*?6M474 7J'7 +z9*8457?J]7\9*3o79@7*4R796C4(6%[E\ : <[H)i]f)ng^)a_59` %DA HT: <> ?!$ind@ ?%?IHg: <H&aJV&lK U@\< :$var%?D;$var&pU%J;T6J;$vara&pU)ln%DET; <  : -KC+ ; *5)tt,H)s-fD2:%?   y< A /i 5 Y&var W5( [5 UD&   2'L&X* 3'4'?*'T.> </vc /n ./@-  =wE, +(. +A/ .D>  ,=+(? +A@ -E  t *=,> I,sA g,?E 1<   =C  4<4<1<|   =:<*@3<4<D= (  *X3=4=6< t  MU;MwC MC$N75BKr(57z&59{05|E|5@>  56A45;8 o>  5C>|OJ:M OOPEgPBjP+<nPO8O͐qdOt PO>QORO1ROASOUSOc@TOUOy@UOVOWOsWOmXO0YO;4[O5]O^.O aOc?bP;sPv-+PM9#+PCpP=QvQQQg9dCG 0YIg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  'X ? f  Q   ! k    XA0  4  e  a &d oec# _kf# gn^j Bpk# ol#   m{L |j}~- Bp# 5 # _k# # L# c# W W fForuUDIfO+ S& W m _k# $# #  # m߻ # fc _k# $# o# {*( # \ D_k#-n #m #    _k# -n #0 # # JX0 k# » # mû # 5# N+_k)#$*#W+ #F--# E_k2#$3#4#5 # m6c# 1k<#= # 5 _k# $# #  # m # i S_k#$#exp # ^_k #$!#{S"#op## Qg$#$# Yg& _k# $# % # -n #  # m #  W _kA#B # ,  {SX# _k# $# F-# # ]  %ŗ# Bp # j # mͻ # _k#  "f   $׿%f%,%J$  %D%YJ%.%71&>&C, ^t Bpu #  tF9  % w8DH:wHI L bI comI )HI T s GnL   mKGo G <I (tnH GF < (E nHG "G: : com: G: D Hh h comh Gh  F  comΖ QHЖ  G  com G . F^(  {*]( nH_( F_( {GR( % GQ( FS( 2HM M comM GM [ ^H{ { com{ `G{ O F  !com " H g gG'  !com& "@G(  #HO <K$N j%EHP &<|;"H'n pu`( )* ' e(# )*. '@ q(Q +pt*\ ' ( ,)@* ' hyI( J), ]- D. +8, {* / c( )* '% ~n(6 )*A 'S ((d )H,o 50 x( S), q  #G5<old4$XG4  #HACcom@"XGB1'Gz03zcomz^8Gz 9 22b  "C0I 0Lg-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,`#@0#D& 19#F 2#GD6#H?r#P: H}#XA I}#\H J}#`O K}#dV L#hqN#lP#p(+(W int &   M 8G kR U   G(i   Ap# n # #  %    ' bJ7 '  V  W  {S m# x!b# O !b# ("#s"ind&b# '# Bp(# (# V# ? ?  R#  S# j T#  U# ? X# Ҭ [#  \# ,L @b t ! l ], !I0P]-m|HP s0 hKI \#8 Nmle_kH`\a c q dI4l-}-d0- !5"j6U! I6Il #0 !E $vIPd HO %jQU$R H A&0 'eV! HH! y#0 X 'YHw #0 Ր YI #0  I$# s B I$L` ;s  fIL ds   j  "ID ((( )(ן ( Z(& Z( ,() !(7(8I>*II*K@P$CKK 8,Ng-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '  x #   1m#9#Q k /#  B# #!1"J7 '  V   #  ?z $ )#  *# +# 1$ 4  + 4 ? ?  Rc#  Sc# j Tc#  U# ? X # Ҭ [#  \# UL @c?t J l ]U ( J# CK# #Vc#tpc# fJc# /K4# c# I#$6K#JH]c JH* mJ&U lhs%ct rhs%c J gmsgc c tc J JTJa4 ! `c? valb4] !pcc"}#$ %gk#8&t' K4l(tokc(e!vcs4'bK4(numc!sc!c>\J!val4)K(cJ)  cpc xpccc1e*}Kc!ecI%!@+?+3#$I:$Sn$_"l( O+~#P $$$$K$,x''+J4)<); -4PQJ(4<) ," val)4Mv2)4I*cK+!!ec,J4 ,,J val4uJ4,p- -K4WXK4c4 J4p-.Xv -K4VWK4.-.!opJ4./  -K4UVK4*../!opJ4//b K4K4# !opJ4/0=m -K4UVK4\# !opJ40p1 -K4UVK4# !opJp4p11G -Kq4TUKq4J^412f9 -K_4TUK_4MJL42T2v -KM4TUKM4J04T23 K14K14I2J433 -K4TUK4"I'jK4\ (J4K4K4ױ4ICJ437: 4elhscMrhsc" ! # !& &+ &7 &C &O #!dop4+/I<478t :c J;val=4!c>-&K?|0#VcH1tpcL0fJcP0JT0CKX0J\0c`0/K4h0Ip0'Kx0I. 0rK0RK222& Z2[c2-J28Ic &CuL 84<S int  M R/6tNL#$/#%{#K{89] 6G i6e K?9:] L[:t:]$ i\6L+ut:(;k ,ui-6*-6^K6(;4< 6 62{PK6& Z6,K/,lLD$F86@6LC6KH6 M6$DP6(-JW60Z644^688z6HKS6,K}6e6@ 6TK<66ZLl6D6X216\}L6`L60L69 6LY6P(u8 +6 .6.6BLa6<wg(C7O 4<KTg-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2 #GD6#H?V#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP!#pW int  M 8+ OR 93 3da  x #   &  Ap# n # #  %    1 '=M O M  O<  1M S# M !S# L "S# /O #S# aN $=# N %# O &H#4 L 'H#8 = BJ7 '  V   #M ] ?z $ )B#  *# +# 1 ]  1 ? f  Q   ! k    X A0  4  e  a & d o en# _k f# gn^ j Bp k# o l#   m {% |j } ~  Bp # 5 # _k #  #  %# n# 0 0  ?For u U If j O   b    ,    0 m  _k # $ #  #  # m ߔ # ?c  _k # $ # o # {* # \ _k #-n  #m  #   j _k # -n #0  #  # #X0  k #  ” # m Ô # 5 # pN  _k )#$ *#W + #F- -# E b _k 2#$ 3# 4# 5 # m 6n#   k <# = # h 5 _k # $ #  #  # m #  i , _k #$ #exp  #  ^ _k #$ !#{S "#op ## Qg $ # $ # 2 g _k # $ # % # -n #  # m #    0 _k A# B #   {S 1# _k # $ # F- #  # 6  # Bp # j # m ͔ # _k #  f Ϛ     t!1  N)M dq pidet# Mf# _kg#N4<<] pidtiM<< pidtiN<=] M/ /O=0=]5 M/ MP0==kn pidti!@O== pidt M/  "N# # Mk=>] $\\itA %tjQ#uOs>>],$#/qT %kr Q&+Nz>(>]&tP(><>]#fO<>@>]'pidtg $4z (i&L@>D>])MD>L>]*OL>h>]'pidt +OZh>> ,tty[ +NJ>T? !N,ttyK5!+OOT??i!}$t!#TP9??]'pid7t!$Xd8!$8!-j :.O?@"/M)@8@B"/~N8@l@m"/]Pl@@"!:N@ A"c(pidt"M/ "0XMx AA#1iyQ2Mn3s(xn4Nl+NAD-#'pidtX#"3#"vN#"Nt $"M/ $5!"]6@%7!8^%9CC:*;P*/ <__i*(__u*j7!"1P%=CC:;P/ <__i(__u  !xMDE%$'sig%-O!MPE G%l$tO &,iQ*&")OQ^&>Lk GG&-Nlt4Mm/ t/NGH&?FP3pidt@_k-N+O6HI&|'pid5t'"N7tG'"M8/ {'"vN9'-_k9A!^BB7"8'?MA3pid?t@#/@-NBCNDiELDiDold+ NtIK($n9($>PW(1pidtV"Nu(FMIA|("BB7P"8(Ax"D7"GHJ(K7"GG  ?ILth : IMuIOvILxOp4Ol4OE^4jMFJJJ J CJJJgMJJJJJ& JK/Ut`K3VtdJKJLJV/LJ0N) J PPJhNRJ9MSKZ2YdKNM\hKON`+`,CT KXg -^ka# # #5 # % #< #{ # #@  #  #$  #(  #,"#0$#4Y&a#8 *a#<,#@0~#D& 1#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqNa#lP#pW XFR"TX" 52 2  Oa Pa# Y#int%Z<'eh5  M 8 R 3a a 2Wa53dWn = x =# M 2 &  Ap# n # a#j% 5 2c 5 2' 1/#9#Q k /#  B# #!1"a J7 '  V   # a 2?z $ )#  *a# +M# 1  2&d% oe # _kfa# gn^jY BpkY# ol_#0% m0e^t Bpu#v a_RܝXW ! {S # x!# O !# ("f#s"find&# ' # Bp(f# (f#!V#?? R # S # jT # U9# ?X?# Ҭ[a# \a#L @, ltwl]VEk3_ `a# n3a # ]wp a\__sZ__nZ?Zs&To aKL](p pSnq a) 2S aL\M]d!pat ^)" )#c 5R Ua\MN]" S)">U)#wcQ$Ry NN]%Z  NO* !c a!*&  ?*'~_G  OOR*` "F q*rH *#retH QsH *'(Wc OxP* "a *"Ua a+"^ba+sd +'Q xPP+ " +"2/,(aret ,,'U~  PQ?,a !ind} Xj,(  p p,'Y_ pQ,R, (` pU` pT)ia a*aWQ,RR- #iRaT'X R@T;-b "(pf-!sep -tp-j  [r D.(Ta&gSaW.&yau. @TLT] "(p.+W    5 a8 (( p)ret 'lR'  LTT.W "% ."5& a., "( - - - .#/ // +/Z   T Q//0(p]a)na1W TUI/ 2j t/2v /2 /2 /.8#3 U/ /%kVaUV 0q " 50"5aS0"U/q0"/[/0&T 0%^ aVY13" -1!pat 1"  a1!sp 24ep c a2len a]2p 2p1 I3&\ 3)end %W  Y[3"2 )4"w 4!op a4len aj5)end p 5#ret Pc 5*6+/_ )R FW 6_ op a)wc )ret )n a%SZ  [^i6*"2X 6"wX 6!opY a47.P#retc ~7(Xc nd 7&Re 58&6_e a8#psf sD(9Ug ,h#r -28-28.#/8/49/~9'_^h_9!s9&K:#ncW#mbss`[sX,#-2/:-%_d  h_`B:f"c m:e Zif a:jf a:(FUf aZg sX.$& sP&&  ;,($ ---*_ ``=;"( p\;#t pT'_T  `ao;w" ;s ;t ;& ;&j  <&[ ;<Z sX.@$& sP&& Y<_k a<,X$ ---'R< pa@b<"(; p<#s= T> pU'aT  @bhc<" =t &=( &j  {=&[ =5|bhcZ sX.x$& sP&& =)_k a,$ ---%R) phcc">"(( pM>#w* pV#t+ U%`]  cek>" >s >#t U( j  Z[ XZ sX.$& sP&& ?_k aH?,$ ---%oSaegf??".V ?" ?"5a?"x^P?"\ @&I\aM@&  @vV@%wWO  g@g@y"N "A#tP T'Pk  @g(h@AG"j kA#sl T#tl U(m j n Z[n XZo sX.$&{ sP&&{ A_k{ aA,%{ ---'Y (hU( S(_+ _9a>U3_4FW5 S6 7asp8ep8)wc:)wp:( S:)wp1:)len;a)n?a)n1?a'T lsDx" D!pat ME!rep mE"u3aEret Es Fe rFstr F&ZaF&rWaGlaXG&QaG a@,%-----.%/ H8/jH/H/H,`&-g-\-P-D28H2,I2 FI.&/rrI8}/I8/J/[J/J+VF fdEa5Ea(^G )bufG(XG (PHa(^Ha)cHa(XI 5 2'W s,yJ9"  K"5a@Kpid^K&\K(O\&YK&^ EL&j aL-P&5aL&`{aLrca@M9_v,xH'F-2iM.h'83~/M/M888+DO M 2N/)iPa(Q)tR (ZSs0(&Ys(&Y:%Q~ ,y{sNY"z N"{N"2|/N"Z} Nia#O(K&Z6OcaIO  PZsL6'(&6'&sD&&\O,'---.'wcO5zzlenO,9(-W-K. (/cO/mO8y3.p(3/ P,(Y---'\ {~2PX "!]^P"U |P"!Ps P&X  Q&2 a+Q( Q a&ES aQ& Q.(Z?sL.(&@sD&&@%R,(@---'[p~CRu!" oR"U R"5aR&j pRt_S&X HS)s &2a|S& Qa  |]'"= \"5> a\+{\VB(  _ka)vV(s\a((p%Za\t)"ot)]"Zwa+]&a_](a&ZZa]&nqa]&(@a]& ^& y^&V^)t nia_&F_<'+# ])-(-(-'.+8(8)(/5(o_.+&  _z)%'VM a_)"L _#tdN %pNWC a])"oB _ `'P7 a8`&*"6 H`#td8 %p+Qia*fgRha)cja(Zks0(&os(&o:%[ 8[`T," `"2/`"5a`"_ka`#iaU)caYxUa@Xa[sia`&j  s&&>7m,0>---,&*0{-P*-D*-8*.@08\*3f*.x03s*/*m,0o---'h_aؠnz5" n"Ԅan"] FoiafoaB[aY#siapcao[(  ZsL604&s&&o>l---604&s&& p,0---615&sD&&Wp, 1---,&*81-P*-D*-8*.X18\*3f*.13s*/*p,1o---']pԩ8q7"  dq" aq"]  q"Ta0r!nwp/Or!cwp/rtsa7stea`siasnwascwa t&}^aLt& td td2 tretpu)tlp.1&%^u&&'uZ)sP.1&1sH, 23---')] ԩuP7" v"_ v"2/Cv'U Hav7" v"2/v'\ Hv7" v"2/v%Zm wV9"k /w"2l/Mw"^lalw&nw[o Pjpawipawtpawcq x r Xretr Wx&saxMUsaT#sisaptaXZusL9[@6@2;9&sD&&x_ka*y,h2---5&Ray%]l_دy+:"j  z"j (z!ckaz"5kaz"dYk/z"F^k/{wm_2{lnpP{to {t1o {& o {&Wpax|+VaJ: +Rau: Sa+So );.Vm m XTm 5na)e1pX)e2pX(I\qa)rqa( Rqa( r )valr )ttr (R^r )vsV+H[a; XT I\ae1p;e2p;)t (T ([ )len(.-a)a,X+P] a<XT[ \a(lU^(T_a(Y_a)i_a(Z`s?E<(&us(&u:0(&s(&:+SR =P sQaeQa)ttS (ԄTa(Ta)iTa(Ta(ZUs?<(&]s(&]:0(&as(&a:+P  = Ԅ aend a5 a(= p(P p)h p)t p)ret )i a+Q< Z>.V: : Q: 5;a(I\=a(u3=a( R=a)val> ( > )pat> )rep> )p> ( T> )tt> )v?V+Q >s} c~a_k~a)p +~T ? pat rep u3a(=p(Pp)w_)ret %6V_د|D" !}"X/}"5a~"U/~"/[/&Ya,(Ua&Va&Sa>&Za&WaR&3Ya& s& &  &T &X_`ret_nap&2a6caG&aL&vX09?Y"62@)x x1 h8>8">8.>88>8D>/O>d@ hl,D- - - . 9/ 8 @Z>ض[_D->-v>-l>5ض8>,>@92>2>2>->.h98>/>@/>/>T<+:9kD-=:.9x&Pp+IRatEslena)ia(a(Zs?XE(&s(&:0(&s(&:%S]_4H" 2"2/f"5a"?_/"/[/O"V/{"FT/"`{a&  /&T +S4HU&Ua&na&.-a%c&vXvarV&(p&X_;ret_&a9?]@9V9MR09Z.9&[x [,D92 E-E.:/Em8!E3-E@6P:G3YE/eEx,h:---6:G3>E/JEͯ,:---,&*:-P*-D*28*".:8\*3f*.;3s*/*5,H;o--- 5DH 2+Z H Pa(" )fda(j a(\)pid(vVa(;Za(-AVv  Ifdua)retw (O(w I)pw  5I 2 BPX;DIfd:a0(sU>a%^/p0MN"o+_"5,aְ"C\,a"/[-/"?_./6&(0p &31_g&^4 &^7a&P:a& = J&T= @ X&C&2Fa&5TIa&yZNa&&RQaH&^Ras&Sal&/UUacW&nXa2(sYZMNZ\s9WU_P9h\9a\9&XT9oYM9|Y/6h;KK&R 6;KiRa&Rs&&R,;R---6;K&ds&&d_ida,;d---6<HLiFa&Fs&&F,8<F---<9`<L-W-K.</c/m8y3.<3~/,<Y---8H3H~/I,I8>2*I.P>/6I;6x>M&Zs&&Z_iZa,>Z---.>ia&s&&,>--- 5]N 2+ZpNp)vpp)lpp0)tpp+Tp6Opw]a(! (D? (Zp(G]p(Bpp)w_(Pa0((+]pOpw]a(p(^p(nHp(Bpp(\p(?_a(^a(D? 0)t a+b^QpXPOpw]Pa(WR(D?R ([Sa(nTTp(G]Tp(ZTp(BpTp(3U_%R^p0R"(\p"w]]a&nH_p&\_pb(|`a<]N>hP-oN.?8{N8N5h8N<6O0?UQ-TO-HO.`?/`O8lO8xO8O8O/O83OP8O.?8OU-%V-V- V-V.A81V/=V'NS p$#X" )"5 a]#td %`& p{%W ppX" "5 a#td %h&R p+hQ" pX 5! a(# p(R$ p'PP pp@Y"N I"5O ar&j Q p>XV -X-X.A/X8X+SsYsr )lenta)indu)tv )cv5(Ww,)varxV%TX{Z" t &Y ;&vX&CX&(pvar V0,@YA--RY.A/\YN/hY/tY/~YB/Y`/Y7]Z" *" Hlpf&  'VR p$"[" "5 a& p 'IZb  $'[!w` _R"da aprc pc ld p% Q_P\" "Sa<"5aret_&  tt 8&CXlvarV&a5D&2a%]I_%\"F P"SGac"5Gav"UH/"/[H/& J tJ wK_C_eCVQeC\%Co[% CS5(CT5)CQ5*C^5+CYaC4XaCSp#_4 :"5a,X6a0D D D DDg a'^EDD^Da L^EDןA^Fg[~V+F\ , ^ 2F]}^+ ^ 2FMV^+FR+DYUpDZaD& ZaD [aD,aDL,aDK-aD-aD-J.aD4/aDL9aD/D3D[ D/aF.ztF)\{xDaDaD1aDcaD 3aDM9Dt aD[ Di0/`\DaDc@aDv-aF8`8) aGiXy` e  `0, /a1Ui2`,  N+8I_kg y`!ٷz! ٷhv^`   8>_k\!( y`hv_  4n8_k!F y`hvd"`Nx#baL$`Mx `OnOeO`p  8n`oxaqp%irW&4 Bz'O'E(8B)Z*e+nT,, 3Cb }g-^k###5# %#<#{##@ # #$ #( #," #0$&#4Y&#8 *#<,#@0#D& 1#F 2,#GD6<#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPB#pW int  M 8+92D 1 D R 9 RH9     Ap # n &# #  % <   R 'Ce RZ Z Mw z {# |# +h % J &O# : '# +p# -# .# { /Z# t 0e#  1O# A 2#( M 6#0 V 8#8 a =#@  F~#H  G~#P  H~#X X{#` J7 '  V  tx jluid k]# ` k]#gid lR#  lR# m# d n# iF o#+ ,#msg-# a.s# a/s# b0h#qa1l`a  Ii\ib  hiUa <Pi 5;biQbs5ڲ aih5 /Q__cPb%izas5 am<h_bnZn ioWaoWbpN p{ PB}!a"B#j$u~%&B/a'\!"C#$~%(!)0C!"HC#$~%bk* j+il,oo-bh . msg5~jX/i0_xC!p"C%{1b(OG 2mp*3a| 4str2s?a<z 1b=a>5mp>i?t(G 4lW!Y "C%e #o 6ybb37aL^Y  M/nowNs8VBOa4j 8 p !b7<(a:s@9&9&9 r:Sa=, 7C$c T&yg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9   x #   i&+   Ap# n # #  %    , 'J7 '  V   #  ?z $ )#  *# +# 1  & d( o ec# _k f# gn^ j\ Bp k\# o lb# 3 ( m3 hsyc ׃ yt ! b]sig c]sigPe]>sigd(]ksig d(<]sighd<d]sigPcdx]sigcGx&sigFECc$]d$h]VsigceZhLvYi[ {dLX]cXd]ddsigcPcQ n sigP cY KsigX ^e28vsig13!0d8} sigtagc"dc#_dc"bc"%"bG"Cdi$c|-e-$] ue$p_"ddp]%Oe("bc%bx(l# "dycN"mzn"Cdz$qzp cl; sigc,c]d cJd] ch@e ] c&Vcc 4 ] 'sig(retc d4 !] )sigU$dZ"*C)set~$} 6c]!" sig\>"rc^r%+c"X# sig+QdX#$! ,c0,_kN(sig׫l-c.d$T&H (i X C/cAH D$ cT00 c C16` /00g00g r0X0Z020212 c* 20٭ 0O00S0hNT0cU0 3U  @1dYx -  @1dc .1-i/1el /19Mo/ :Cf T&/10g-^k ###5# %#<#{##@ # #$ #( #,"g#0$m#4Y& #8 * #<,#@0#D& 1(#F 2s#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN #lP#pW int  M 869=O 1! O R D RHDW   ZWnw z7 {# |# h %) J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#`  g Apg# n m#  # 0 0  ) ' J7 '  V      " # %G|  [V 6  7 #  8#  9# H :#  ; #  <# =G G H Ig K  %y M O= {S P#  Q#  R# dC S=# \ TC#  % U     <f^ T&&]c\ zf]f &&]fd #f &0']fd 6e[0'L'][fd _bp[Q ret[} !%g "c "bp[e L'']c #aC$|Q%r!f "bp[&nr'f  '(4#C%(D)'lf ( )~bfd  bp[5*Kg+f )T)Sbp[~,n U'e T)t)bp[,fd T'g t)) fd -g)L*CZ n b.i T/]g V0kg[ 1fd 22r3bp['fc[L*L+u4 fdb *d4e,sbf<5T8Dh %s%g#Z PDs% %t %j (hD) +f$L++ bfd" 6#9*%&bp&['ez[++W 6 y&fd{ 0Ff[ 1bp[3nbp[',f0 +-l fd1/ fd2/ 4f1  m1 $7 l,,H8 M(D) k9f -D. fd Vg :nfd '[f D.. fd 79f@ ./U zf?t:ucA / /Bg7 d/6g8 \/e8 `/gs X [/bg ;m;m; C ;!f WI; 7;& | G# +?M#uwp#pW RTX)& &  OU PU# Y# int%Z0'e\)  M 8 R )  Ap# n "# U#%)8 &)N &'i_Uoytign NvalO#lenPU# _kPU#iSUviU! .VV# jW# jXU# `jY# xZ!#oj1U83H3]jH34"}yYj~U iU:jUMj45`'ivp'=jUjUptrUOjiY pj#56#d!"N"v$U#(jT$7jRN$jS%FjUN nVU iVUTvjx6$7a!7jwN&dD|'~'r(D)W*+,j9U$77Z!8yp:0_k;UYjN7t8l"y -rNU.\/__sZy/__nZ$?Zgit8:0- Zs1tU-[X-ZgX(D-&gP&q_kU2E'''i<U:;A;3c=U-[>X-|?UW-ZAg`((E-&hgX&h 2@Eh'''4D|4"4"4i U4[ 5i3U(056UN BC}k ;lAig-^k###5# %#<#{##@ # #$ #( #," #0$#4Y&#8 *#<,O#@0#D& 1#F 2#GD6&#H?a#P: H#XA I#\H J#`O K#dV L#hqN#lP,#pW int  M 8+  ZR 93]lZ   x #   &   Ap # n # #  % &   < 'ekKG MYl "|Sl #m $)l %Y  @ 2l Al# Bl BD# G l H# k I# l J|# O 2l Pl# Bl QD# l R|#  Wa 2l Xl# Bl YD# l Z# 9l [w# tk \w#  ax *k b#  g m hZ# \m i#t ;gl < Cb K_rt Sk ]l call jx  m 4H m 5# 2k 6# m 8# ul k# Il l r|m <m " H rm  l $S# $m ,# \k /# ,m 2#  #  ?z $8 )#  *# +# 1C S t !Ml j Jk# ll# km# Z k;;]sigPIkC;(< (sigAK mBi actD~WmD}l (<<<] l<<h<| !lh<< sig ll<$=]sig M$=4=] !ld4=>+  ;keVk>?]3sigJ !bm=??] h"i>act@~#8m?@ $i%actݔ~&Wmݔ}'k"#k^@lA (] )XE_&kV e &Cmu&k *** +H80+>+D+A+gP+S*Z*& Z*7*V/8*c9*:*C1:*0:*k;*8 ;+ PL00 DCm lAXg-^k###5# %#<#{##@ # #$ #( #,"+#0$1#4Y&#8 *#<,#@0#D& 1(#F 27#GD6G#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPM#pW int   M 869=O 1! O R D  RHD  + Ap+# n 1# #% G ]'Cp Re x # ! sw  z  {# |# 6h % J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#`J7 '  V   #( 8?z $r )#  *# +# 1} 8txj uidkh# `kh#gidl]# l]# m# dn# iFo#M55{n_lAB]gop^ 2nBC]op& JnCC]0D argW mCC]pchj mCC]m&C,E s$ t$ op% st1'st2'~r1(Vr2( n,E0IM opy arg r  m! GH6"("m0I$J 4opVr`# n$JJnhJDK>$f]patf{opgmimBDKM- s@t@4opAR$_kAplCrC~%.-Dn&nsMO: opqe$)q$)q $_kr* .tTmOP/ PwTnPdRZ %y&!dRpT+ '(andpTT-_ )T*v2(orT|UL )T*v2+ |UUk,n -\nUX< $m$m%-m. pE3/E0 )itt8nOXYinN $\U%A&`y@(dn,h ICo YPbfg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' 15#9#Q k /#  B# #!1"JJJ P cD (Q#M#/#@W" Bp##key$c# )%a# &# '#  (1 *9 `+9# ,# s -# ? .o  c# c# _k# Pw; O _k P# _C Q# s@ S# D V# RE W#   7 Y o/-- o7YPY]5cԄ6i8n9QnPYtY)a a-oVi?o-( -  p3W!^otY`Z'"(R#E w$'%Y0Z$&F'p'((()o`ZZ]*as1*as2+j &(F,WoZZ-|oZ4[0jc[.elt?y-oO-4[l[Nc.alP?/PoR0Pc0ԄQ1iS2T2oT2KU/o30c0Ԅ1i!ocl[` ci11j"Ԅ$cYcdXtl2p;ph,ol"o-#@F6 $$&`F('8((3Ff vc2o2wo3F 2wo0"04F$$&G((!>oc``7 5scV6r-T-+p]c``i$ \c+o^-,pE`a7olaPb kckc-eltm?+ n-K.noijo&889A  E8K g9o> 'LCYq Pbsg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '&d oec# _kf# gn^j6 Bpk6# ol<#    m  B+^ty Bpuy# ^ c S W  {S # x !# O !# ( "3#s "3ind &#  'c# Bp (3#  (3# V #7 )tp +Zooa D 9tpPbbau8paaeoT Opobxc #au+iIaeotcxccmauiaeo_pocLd2Q]croVqLdXeaunsc aeoo newo qXede]Sau vc p<udee r=u (>o(!qjue`f;!aiuf!a1ku!aeloUnewlo!!qYc`fg!ԄVo!endVo"sepWc2"5XQ""j ZcYtZcTae[oV"\p"Z\U"\Wreg\o"Iqcgh"au"sepc"5##ph(hS#aeor#q(hi#|au#i#vc$newo=$aeo[$hq3uij$W1u$(2M$l4MUi5VWpujj$ (M %$auqMjj(%S aLuS%rNoq%r1No%Gpoj$l% au%n%_k&aeo<&reto&i&zqo$l0l] au0'Sp!u0llC': W ub'a"o't#c'p_ll'a a^u'qclo' au%(5C(%j cb(%!qc(isc("aq Baeo(%Z(%)&. ' (q?o4pc) a>u)ret@)t@c)iAWaeBoUpM4pp) au*%( M0*ae!oN*t"cl*6qMpLq*1 au*%(M*aeo*qbcLqXr+ a_uD+pat`cb+rep`c+u3a+a2cu+edo+tec,ifsecX,"qe ^  p9cXrsk, a6u,Ԅ7,p7"- R8N-58-$h:op:o-i;.ifs<cd.sep< f''gNC+s sg-^kU###5# %#<#{##@ # #$ #( #,"#0$"#4Y&U#8 *U#<,#@0r#D& 1#F 2(#GD68#H?#P: H#XA I#\H J#`O K#dV L#hqNU#lP>#pW RTX)& &  OU PU# Y# int%Z0'e\)  M 8 R )  Ap# n "# U#%)8 &)N &' J7 '  V  &d oe# _kfU# gn^j Bpk# ol# mU  ZW  {S A# x !6# O !6# ( "#s "ind &6#  '# Bp (#  (#V #Z7 ) "Y Bp #Y#key $# ) %#  &#  'U# (1 * ` +#  ,U# s -U#_ .j< !  "# 7 #U# _k $U#up %# 9 &# 8 '#0 ( ? ?  R#  S# j T#  U# ? X# Ҭ [U#  \U#:L @6t/l ]:\F__sZy__nZ?ZFgr]6stw.s[.len\U.exp^.t^T.-_U/val`6WX s(tt2/var&Q/!5'Uo/"&s)U sUtu/sy/iU/"UZ#cU"ZgX"&gP"W&/$HG%9%-%!szuv0D sxH0!Krx0f0!y*0t{Uret{0ind|U0ni|U0rvv1 s21!Kr0E1!*X1tUvarTAs$vwk1C s"1!5#U1len%Ulq&1t&1 &I2l'r2var(2&rwpy2 s2!5U 3!7sU+3!*_3lenU3ind64qg4t4 e5l5var5';rpyy]V s"6!7sU56!*S6'?ryy] sq6!5U6!*6s@Uy@z6 !?6tATrBU6lenBU7sU@zL{.7h varM7subk7lenU7ind67ae7(tL{|7 )var(8*(\8*_kU8+i68,lU,aZ-ps]|8}9M *Y19)indZ6O9*[9*_k\U9.r^9.:_9 r<8}|:var9,:!D:J:!_k;U~:a=[(>:w?;val?;;*?d;#len@Us@U;indA6;PrA6;/ro(#s#t00rU#lr|6<(!a<!_kU<(<D<valVniU=$`G)%,1G280=2BY=3L2X=3dSs8=var=!=!_kU="DT(r=8Ё>)var<D>.Ls>b>4W?V(YrЁTu>*>*sU>+var>(sT?o*;?*N?*_kUl?5var(s<?*?)ind6?*?*_kU@4T(ur<9@g*d@*@*_kU@,subp4T+ind6@.lUU@4U6"6"6B Ɏ$6[&6'U6C(U78I0lmQCt W0 RVT0XViff O P# Y7# int%Zp'e  i  M R i 1m#9#Q k /#  B# #!1" t\%__sZ__nZ%?Z thAE= =A%[AQyAEtAiTcA5Z;[ytDHsi BtZLpx&&%PG&&%9BzGG&D&%bBzG8t mhBatmBftmBi!Cj!2Clen!ECt!YCt!mCj "mCH t2!tbm= `a%tclhscrhscid ktd td td 2tdtletre j fm!t4mԄ3end3t3{S3n5i5 j 6mt6"tm#= #%#_k$j m$qtm%tem Ԅic Z&lrlpj' &' &'%()@VZmC*= YC$Ԅ[+\%C+t](D+t]QD+t]dD+t^%D+t_mD+j _mHE,i`E,j`E,c`\F%c1`-ZbD.t樌0H-&ӧ+&%oF/zHH0F0F1pHػH23%F31G3=\G2G3SG2_2k4w42H0G0 H0cHH3H3I224L-&̧-&%P/zI07I/0I.#HI292D3OUI3ZsI3fI3p"J4zI43DJzI'0mJ0JI3J23J556Mt:pTCu g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t 'nt9v3 n!"u4,Fiu6QnknnTu9vJKk.KuZvlyu puY$v[rkF!u.Cs1-ns2-ni/@uAnAK^W?mKp@K7u@K v@KԄBLendBQ8' Ew e 2$p.xYpT\Q +$XQ9< Ka#N 6K8Z ;Tl] += Qy  2$s(xlQ +$R+z YR+@x R0uwR04S0 [S" # $8 <  22 (y[ ySW 0j \ S)hf]S'buf^= h@ # # $/ j >xT?!x ؝-T LT@i Ty؝].w T 'hf T'buf " x# # (v> T+j=Tfd? 0j ? U'buf@" F# # ABCc|BeBeB eB0L$ B!f WB / C)R tC4X D2CA[ H2Cw 82Chx xCw C,z <2CRx L2C ` @2By BA B< B&y Bw Dx Bw7 By7 CWy `2Cx T2C z \2CFx P2Cy X2B B1}YC 10g-^k ###5# %#<#{##@ # #$ #( #,"#0$#4Y& #8 * #<,#@0#D& 18#F 2 #GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN #lPi#pW int  %  M 8F9M_ 11 _ R T  RHT w z& {# |#Fh % J &j# : '# +# -# .# { /u# t 0#  1j# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#` ,c ؅ -# k .# . /# 0c#  y '  # # ч c# ? #{ #   Ap# n #  #  0      ::: @J7 '  V  & d o e# _k f # gn^ j Bp k# o l#   m  z7 o {#  | # }  Xc h i s  X&W  {S # x!# O !# ("<#s"<ind&# '# Bp(<# (<# V#?? R# S# jT# U# ?X# Ҭ[ # \ # XL @ Bt M l]X , )4  # #  # v #  # ) #  #  # # #$ 0#(  #,  #0 *2 %o C # # _k# w/ 0# V1# _k2 # 3 #  4# `5#  ign N valO#lenP # _kP #iS     iUe .VV# jW # jX # `jY# xZe #  0v     9v3   "u4 c   iu6   z7   Tu9H>BwF6  K  F{LH}- {S.# V/ # k z0V I= >  G7 ;΂ڄty(y .$ $/# w0# )1 #Ly2 5 $  g g 1] = 2UT{ Qind } ] EU  XUg =  U  Uret ^!p U!r U"l #5 U$|w Р] = v V%x !qcy !V&q{Р04V i T';}J0TSV\7jHc~VjI\V#FjKcV"idxL #w|L V#McW#nN 7W h ރ TtUW7jcW  tW7jcW(a cW= ` Wm1b cUdfnc T!qcd X  `"X{NX)51!fnaX*; K+Z +N e  `X X,ind X Y8 0Y!i YY!c Y#> Y# Y-P (z.  Y$- (Z#/ FZ#t0 YZ#0 lZ!i1 Z#,1 Z.ئ4 (z# `Z$"Z ,{  `[f <[,key O[# x[# [!i [!cmd [ps (&[= &\Z O\% ) ) ,)*  ({$x\= \Z \%# c]#]%Q )),) ))  j $<][]!p y]) U/z Łc"d"nd(p]߁]Z ]# ^0`|1`2K%%3K%#h  ^2KZ# ^#1 ^3 L!l _"tl "vl "dl !rd9_*8L+3PL4 m_52pL#_6صp!t_7ر "ij 2L%G2L#o8#`2L#.VUW`)كH) Dval@):<)Ѓ8)| 4)[ 0) ,)Ԁ ()k $)  )6g )| )ۇ )*&),  *(lcpH`= j`Ԅk  a,endk ?a,qck sa]{k a#jmcb _ HȺ,b$= ] WbZ^ ub%b !retc b)Uc U)j` cPinda L Ⱥb=  bZ  Qc#c)jc))u)ˈ )Ն /Dgf'wcjvc) x {% y)y})y{!iz c%Ԅz 2M#7d!tUd*0M+  '||TLsd# Ud8}c4= "i "len %d %Z %j c |Ld= dZ &e9XM:ee3M4e5554';f2M!tYf)(c`) \)3 X)T} T;{cf af= _fZ` f2M#g)*bc|)Gc x).Vdt)+e p)3f l)T}f h<  1g=y~PPg  P{gN7jcgM zg {  gmŁ cg#~ h#{ ch!t h#4 h% !wl hsb 1~>N/ .+m+a3N#TW i#[W 0i%tX %tX 8 ?ti %F % 8˄ Ԅ "s "os 8 ?end "e 8?Ԅ %"s "e  Uc0Yi= iԄ i,end i#w i!ti j%~ !qc j%0 #jcj%59m0N+3HN54j3hN!s4 k!e4 Ck#o|4 ok!n5k9N>+3N55*44k>dx=+*N<+3N4k58? = > "ret@ "r@ "s@ "lA  ~e 0k,sb lc 1l,qcpd Ol#҅f l#Ոf m!retf Ym%g !csg lm*O +3O54m55@s 4m# ,s m n,qcp /n v 4cn u n,keyu n"cw )#x u)/pxT%x   ^. n:!, n,c, oQ , o}-9o#/bo!r0 o)π0 Xrrs0 Zn ]t!m o,cm o[c ]!b o,cb o   To"1|  p "3p){ "V)u "W"r    \  T`]J"1| Fp}  `h]" Yp,key lp  hp]" p,key pۈT  p|]"1|S p}?  |]*#k> ph> przM  ]V#1|L pȉ1  ]#k0 ph0 qzF  ]#1|E qM#  ]#k" *qh" =q;  ]&$1| Pq  ]b$k cqh vq   8q$1| q){ "X)u "Z)1 $Y)=~ ["r  K   8@]%k qh q G  @qz% r,key 6rr P){ "W)u "V/| %"i} "j} %3~ / % c s Tr\&߁ rZ r9z%HO %&3pO5%5%4%r4%'s)6g len )=     $Ps& {s,key s"r )'~ &U    $s' s,key s"p !r t!t 1t ?8  etZ'k7 th7 t }*  t'k) th) t {  u'k 2uh Eu m  Xu(k uh u    uR(k uh u ~0  \u(/ v,c/ ,v 2  \?v(  ^v,c  qv)  T<́ Tv f1Tv9)$0v%B2)R3 U'H\0vc)B[v'm0(w)BlGw)n V%n 'B(ew)#c}Cw)RE V ߆ (wC* wk w)BT6DT)0}U e~ w* xk 1x%B  Dx* oxk x%B <| Lx/+ xk x%9 ) T | Lx+ xk  y#By#a iy7dt+#0}y3O# y%  (  y4, y)K Z"at!nv8z#*Vz&'N @tzn,#8O z)tPn,f ~, A@z,B z , C y C}cC~ߵ 4CG 8C3-  C  D) )|Fcd)M|I )2L ) )= )"v c)`w )g{x )f|X )Y ) { EEE E%9 EF;?. N E4" E0L$ E , F E[E~E EE EE EF EXF G  G~ G|}GG G G Gw Gy G~ Gć Gk}G G% G7-G3 GuX"Gt`/  Gui"G EnGB~sGG~GG{Gp$Gv$G| GMv Giv&Gzv0  G0 + G G Gk G G G G] E Eڂ E|d EFx E Et  EZL EED 7r1HEg1Fc? Fۀ d2F Ig9O |]CF   int  M R^tBpu#uqvut B] (AP BpCS CR ;S6]% (R{ iT6S ^ ]m (]/{ *]M{_k{~"h2]^C& Pg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  'z o{c# |#}t   {WcPlenQ{]sc{dc{n|ȊRc+|OJ| Ph|_kQ|iS ܊cP|c|c}= c7}U}retct}pc}rc}tc~len0~P~indn~cP~yc~patc~repc +JQ]GVliX cZrcSc cԄendlenTj cb ?_cA `__ka}icTrd27Pπ4c 5_k66i8r9T `C Pg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$ #4Y&#8 *#<,D#@0#D& 1#F 2#GD6 #H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP&#pW int  M 8+ OR 9      J 7    '  V    Ap# n  # #  %  6' 1 # 9# Q  k  /#  B#   # ! 1"tcP|cu܁clenj c rcAsc c|Yvarc c߂Jc4HclenIEIc KctKc׋LcMc4cHԄfendքlent cXtcJt2c~dxT%dHƅ]H&varcc#fAovarclc̆ry<vc% &O<PCvalPcn!@P"(c"ȋ+c",c"~0c"a4c# # P$#DE#PE#%#%9 !bC׍ (g-^k###5# %#<#{##@ # #$ #( #,"+#0$1#4Y&#8 *#<,#@0#D& 1(#F 27#GD6G#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPM#pW int   M 869=O 1! O R D  RHD  + Ap+# n 1# #% G ]'Cp Rew z {# |# 6h % J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  Fs#H  Gs#P  Hs#X X#`  ?* ?*  R#  S# j T#  Ul# ? Xr# Ҭ [#  \#:::L @K:e:t@l ]xx juid kh# ` kh#gid l]#  l]# m# d n# iF o#$$͌xGˈ ވ >RQ05SrTN W \x ։_k6)T$MgS`]\_k st( ZQX}_kYZYi[|\,)\zG]]],!^~"O~ !_!`!Qa0U  #s*0H6  Hэ G1_kOS` |C)z!~$O) %4 &&_k'G#cmd#var׃(| ُ_k) P  *$D+ , +( 3-g|] Q-v] d Twv "J.st F7(o  #s?/1/1/// r/K0/t /0wCl20cIwdC (|ƺ10g-^k ###5# %#<#{##@ # #$ #( #,"6#0$<#4Y& #8 * #<,#@0#D& 13#F 2B#GD6R#H?#P: H#XA I#\H J#`O K#dV L#hqN #lPX#pW int    M 8A9HZ 1, Z R O  RHO  6 Ap6# n <#  #0 R h'w z {# |#Ah % J &e# : '# +# -# .# { /p# t 0{#  1e# A 2#( M 6#0 V 8#8 a =#@  Fh#H  Gh#P  Hh#X X#`J7 '  V   _ ? f  Q   ! k    & d o e# _k f # g_n^ j Bp k# o l# m { | j } ~ ^ Bp ^# 5 # _k #  #  # # d z o {#  | # }{t%     (@]< oP fri5  X7 @6ȏrp8on9 T<0P< Y\!N"ڎX*#o>$j T$uU$uV%wQ&Xda'fd (ToP) 'fd 'riߒ(Vg V*h *KGo*ToD*obC B j@_kA rA riB+fdD +rD g    j_k r ri+fd   j _k  r  ri+r +fd ,5,z--v c triu,jw+rx +fdx +fd2x 1)  fd' (,%*, + +fd2+ +fp,+t-u,-uF  ( fd  , ,ˎ  +n  +e  )l u jo_kk +*mT*&(n fdn (5 n Zrn *ӎn 4lfdo˗*EpriqW*KGro.PP !! ! ! !/P0, 07 . PN ! ! 1 2! /P0 0 2 ~2 }30 D  !!4t  3! !4B (HH! !x !l !` 1T q5(80 . Q9 !* ! /hQ65 6A 0K 0V . Qp ! ! /R6 6 6 C0 c (R! !u /PR6 0 6 6 6 0 5P  ,t7  8o9U[g# Yo>#]Z :j\:\:ӎ] /; Rx! " |M#(ol#_k $] U$ oTc@9 p2=t ; =4"nQ!|4o itp #slX"i"nˠ!L itp #slX"i2"nE$qPc itpo %p &9rV"sls"itѡ#ntW!Ց[Pp itpZ !Ȑp" itp M!`M itp !{ itp ɢ!Mܢ itpL #slNT'F4D% %j3P"sl5n(B6"i6"n6ȣ!ΒqD[ itpp #slrT!܏c/ itpb Z#sldT! x itp #slT!r pitp )֏#slT!FSpL }itpR 5&U}V"iVS#nVU"slWf1$%L%8*Z+?Y,v[$'qץ%$mnindn %?oNcwpl%8p&JBrT(snĦ"vt-R./R0  !Q?Bcmdnj%= }%?ind#retZ"clק"l,#wP,i! nJ%= i%Z"qc#dfnn1h2sn3pn*mn2patn4= n,retn5V| sl%un%= na"i"m#not["ret&\np#tnX6,.7,8-S..|  éitp 9slU! "8itp c%= "ret"sl("i*"n=(̓n]!"({$cs$%= "retȬ(V(&_k!Vo*_:cs$+= ,sl*'/:cs-$+= .,l0,l20,sl1,nw2)2)̓3n*|3+$zn+wo{+T{:nwp{:cwp{,ret})]~n*:cs$+= +$n:ind+?:nw:cw)bBn,sl,f,v) )h,ps,a*$/:cs)$+= *+$+n:ind,+?-:nw.:cw.)0n)G0n,t0n)1)`1,n1,ws1,we1) 2,cl2,sl3'-(1"fcs$Ncmdl%o%Ԅendӭ#ret[(VG($n?)wo#nwT"cw(?"tcs$6*)\).G.</(S8S;_@S,.|.q/hS088800ڰ0 ;SV.....;3S<^..t.h.\.P.E/S88000s8=0Ӳ-8T>?|Ȗ?K̖??w??ݒ?80?D?X?l??͐???eЗ?? ?_ ? ?Ӓ4?H?‘\?Œp?ڑ>[n>/>%9>F; <@n@@y@|@zX@@m>CQ A>R nA>٭SkC `26g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ';J7 '  V  " Bp##key$n# )%l# &# '#; (;1 * `+# ,# s -#.`0t( <# !# -!# ͑ n# W!n# "n# #n# bB$n# %n# u&n#$'8y`2x2]Vx22]),~G22GcmdǶcsG2G283vret3G*\G834Acs[Glnew]GUI4 5csHGѓ 5$5])lǷcsG $5|5ڷAcmdnT s|55 !ߓ55] r55+F56JcmdnicsG""#d,mC 66 int  M R6, uP 6:mC 67g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '0J7 '  V  66]VaޔD66˸Ŕja6p7ha]i3 kaQTap77o]S UaUΔ7aՔ8 98 oC 79g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  'G79iH˹ c) ٭/t2^ oCj99Q intJ/  M R/&doe#_kf6# gn^jBpk#ol# m 6 w/|0#V1|#_k26#3#  4D#`5# %6 ,C ?( F ߕ4 , > \ ", <4$\ I,d\,\9 q,'4\a ,ҕ.<\ ,ߗ5D\ , >L\ , L$T\ 9,\L\\) a,2dtd\Q ,~jl\y ,pt\ ,Uv|\ ,\ ),w<\ Q,d\A y,u\i ,\ ,Q\ ,:\ ,,\  A,$T\1 i,F|\Y ,ϗ#\ ,O\ ,_\ ,ƕk\ 1,D\! Y,l\I ,]q , ] ,{] ,C ] !,'M4$] I,Y\,]9 q,Ėe4]a ,l<] ,uD] ,L] ,$T] 9,mL\]) a,utd]Q ,֗l]y ,R t] ,~0|]  ,6I ] ) ,ԖS< ] Q ,Ζ\d ]A y ,ܖi ]i ,y ] ,- ] , ]  ,H, ] A ,T ]1 i ,| ]Y ,a ] ,+ ] , ] , ] 1 ,D ]! Y , l ]I ,' ^q ,>  ^ ,ZU ^ , b ^ ! ,]r4 $^ I ,~\ ,^9 (pCo9<g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2 #GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP #pW int  M 8+ OR 9       J 7    '  V   Ap# n # #  % 0'&dY oec# _kf# g0n^j Bpk# ol# d Y md " Bp##key$c# )%a# &# '#  (1 *E `+E# ,# s -# K . Qto  c# c# _k# i9:(o=opt[ U &: ;Lo_k׺cUB ;<(AC=C[ C0CWDλtDEcEc '\2 "t <'qCC<BQ10g-^k #n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y& #8 * #<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN #lP#pW int  M 86 ZR D    Ap# n #  # { 0   t  ' n0     %}-9 {S.# V/9# z0>U ? J7 '  V  &d oen# _kf # gn^j Bpk# ol#   m tJ tnV9j k3 2nV49j <B (i&K5k ̼lJzlJJ_km optm nn<nn:nn<nnZnnxYnna?t U8U3XUEpU Q]Ծi!!"%  !  ! n!2 "&! U ,sC֘BC int  M R/J7 '  V  &d oeu# _kf6# gn^j/ Bpk/# ol5# m; `t }6BlBh b6lBC (aFΘcLĿ ?6CC (>Fޘ@L9t -626056C186|tC C@Dg int  M R/&doeu#_kf6# g{n^jBpk#ol# m 6 t 36C@Dqe (2 V45uU2"[,uPuCO@DXFg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '+&d  oec# _kf# gn^jA BpkA# olG#    m MW  {S i# x!^# O !^# (" #s" ind&^# 'c# Bp( # ( # V# ? ?  Rc#  Sc# j Tc#  U# ? X# Ҭ [#  \# (L @c^ t  l ]( #G@DXF(FX L, LJ:LhpMXq MMDNc2Nc;Nc*numOS2 "X vCXFNBg-^k###5# %#<#{##@ # #$ #( #,"A#0$G#4Y&#8 *#<,#@0#D& 1#F 2M#GD6]#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPc#pW int  M 8+92D 1 D R 9 RH9 w z  {# |#+h% J &O# : '# +p# -# .# {/Z# t0e# 1O# A 2#( M6#0 V8#8 a=#@ F#H G#P H#X X{#`  A ApA# n G# #   % ]   s 'J7 '  V  & d o e# _k f# gn^ j' Bp k'# o l-#   m 3   ? ?  R#  S# j T#  U # ? X# Ҭ [#  \# ZL @Dt O l ]Z XFFs_]FGŁ\e^V_"&MGHD(L>oNoptO OVmHI!el@ŁnTnieop"IK{mBterrr%< Ł!nu"KNd (>Ł2O  |o#opt1O$MM/%&MM'%'/XG$(G(G( Z(ZL 1(9 A(ƙ^(2">(t 9(C:)'E )G4xCGNNO/ONN]Ok.V-int\97ONN]k6V@` 1yCNQ?W0 int  M R:t+U5!95 ;kabV؜ߞ]0ʝOț} ? ? f  Q   ! k     XA0  4  e  a &d oe# _kfA# g n^j Bpk# ol# m {3 |A j}~  Bp# 5 A# _kA# # 3# #> > MFor u U+Ifx  O p   :    > m _kA# $A# # # mߢ#M c _kA# $A# o# {* #  \ +_kA#-n#m# x _kA# -n#0## 1 X0 kA# ¢# mâ# 5A# ~ N_k)A#$*A#W+#F--#  Ep_k2A#$3A#4#5# m6# k<A#=#v 5 _kA# $A# # # m# i :_kA#$A#exp# ^_k A#$!A#{S"A#op## Qg$#$#@ g  _kA# $A# %# -n# # m# >_kAA#B#  {S?# _kA# $A# F-# # D # Bp# j# m͢# _kA#  f ϨA tGB plen%%BANxQS! (A~j CAYCAVOCAoptCAQlDSDE U U- 6 PQibA)abA<xQQOI varn!9 AA!2" zCQ_g-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,`#@0#D& 19#F 2#GD6#H?r#P: H}#XA I}#\H J}#`O K}#dV L#hqN#lP#p(+(W int &   M 8G kR U      Ap# n # #  %   '(PG &&& ,J7 '  V  &d oe# _kf# gn^j Bpk# ol#   m   t w /  0# V 1&# _k 2#  3#  4 # ` 5#  5XQQ]^QQ]1dQ(0Y )*`\*a{+ݠXLX! LXtX}#s !}tXX#s 'şX\Y',sF&&d'\YY ,s ':YY* ,s'ʡYYQ ,sWgY\9 (edءfihhij j1JjO0jxIk',\\% ,s'd\]L ,s3'],]Qs ,sp',]T] ,s'T]|] ,s'|]] ,s'']]E ,sd'\]^8 &(^^ (M yp"arg}^_2 ({]|[|{~lU"argϟR4--- - C .-ן 8 -Y U-& Z-ZL 1-% 9-F ;-ߕ </ƙ0-D-t F-[G- H0K&(00L&,}C^_ig-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '  6J7 '  V   ? f  Q   ! k    XA0  4  e  a &d? oec# _kf# gn^js Bpks# oly# J ? mJ{ |j}y~ Bp# 5 # _k# 6# # c#   ForuaUIf9O p   m _k# $# y# i # m # ca _k# $# oy# {*z # \ _k#-n #m # g  _k# -n #0 # # X09 k#  # m # 5# N_k)#$*#W+i #F--&# ?E_k2#$3#4y#5 # m6c# k<#= # 5p _k# $# y# i # m # i _k#$#expi # v^ _k #$!#{S"#op#y# Qg$ #$ # g _k# $# %i # -ni # i # m # "   _kA#B #   {S# _k# $# F-&# ,#   #c Bpc # ji # m # _k#  f  o %7+  ?  ?  Rc#  Sc# j Tc#  U^ # ? Xd # Ҭ [#  \#, , ,  L @= , W , c t  2 l ] { j z_hA (xi hy@{o{_k{{~-{+ {{{Xopt{t|cQr|cvar}{ /~A V ccs(@ If,R@V o`V tv{ c%!(f`f9u z"i  #ehit (di $Wii] (Vi %%% % X% %2 "i %CN%t OtCilg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '&d oec# _kf# gn^j6 Bpk6# ol<#    m  Bt/Qx__cPڢ\ilL([M*ˢ][Ţ]Zi]Hlen] ^cs^cZLiZiilZ,j8j6lZkklQ8t TClnGg-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ' ;J7 '  V  &dd oen# _kf# g;n^j Bpk# ol#od mon޻tD (#M#/#@w /  0n# V 1$# _k 2#  3#  4# ` 5n# nw; O _k P# _C Q# s@ S# D V# RE W#7 Y8iinbi*3_ln (^j `_k`IoptaaxV#V .!8VTIV _"""% 9"F ;i"9 A"2 "" m " n 2Cno int  M R/&doeu#_kf6# g{n^jBpk#ol# mt B.6no7( (-b 2" +Cڣouqg-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,#@0#D& 1(#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN#lP#pW int   M 869=O 1! O R D  RHD  x # ! w zH {# |# 6h %E J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#`  Ap# n # #L% E ' J7 '  V   # '?z $a ) #  *# +# 1l '| чMW  {S # x!# O !# ("B#s"Bind&# '# Bp(B# (B#V#?? R# S# jT# U# ?X# Ҭ[# \#^L @HtSl]^! ^ ^XtMou jK_kL6NHcOa{3PE fdPj P!`{PQe5RX~bS~T  V,{ nfvV, V,0:V,YpWq WWkCY,AFY,D&CZbFZ t\"tt\ ^#Op$2oom%Q%E| ) &m3uXu 'j1'ӣ2"(_k45)ױ4T*%Xu`u] 'j$H+_k&&`uu[* '')jU)j T(_k,,,ga,Z,& Z,t A,cC, 3C,D-G<Cu| 10g-^k #y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y& #8 * #<,Z#@0#D& 13#F 2#GD6#H?l#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN #lP#pW int    M 8A eR O    Ap# n #  #0  ' x # ,   #1 A?z${ )&# * # +# 1 A  ? f  Q   ! k    X Av0  4  e  a & d o ey# _k f # gvn^ j Bp k# o l# m {  | j } ~ u Bp u# 5 # _k #  #  # y# { #For vu U If N O  F w    |    m v _k # $ #  #  # m x ##c  _k # $ # o # {* # |\ _k  #-n x #m x #  N _k # -n x #0 x # x # X0  k #  x # m x # 5 # TN _k ) #$ * #W + #F- -# E F_k 2 #$ 3 # 4# 5x # m 6y# wk < # =x #L5  _k # $ #  #  # m x #}i  _k  #$  #exp  #^ | _k  #$ ! #{S " #op ## Qg $| # $| # g _k # $ # % # -n #  # m x #    _k A # Bx #  m {S # _k # $ # F- #  #  m # Bp # j # m x # _k # ~ f ~      tk3 _&  ` # n3 ay# "  #  %g |  [ G  H  Iyg K %y Mg  O {S P< #  Qy#  R # dC S # \ T #& 1 % U > G r=fn?yfd@ ױ@ b u{] _y (` _ka 1!mc {"xc !?c !Fd!!3d!#_ey!f] C$out%@x%W!n3b o%@W&r ' XW( %pW)$ )/ *: x  +I{|],,, {- Ex , !, Z ,& Z , [ ,L, ,- ,!f W ,)! , , ,); ,; ,>< ,= ,-> ,? ,t @ .kB @·Ck|`G int  M R/J7 '  V  Q ? f  Q   ! k     &dz oeu# _kf6# gQ n^j Bpk# ol#z m { |6 j} ~ P BpP# 5 6# _k6# # # u# VutPu|H|OuretQur\6H|`y([g"e]6Q^6V/ ^6Xopt^6 _u_u_m,env_mJY_u~ $_u(~EmZ6& Z69 A6u2"gF64GaI64C`hg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '0J7 '  V  &dY oec# _kf# g0n^j Bpk# ol# d Y md tͤ`]٤](\"e^PH ,(OK<HiY(;7D YZ0-1e12 KCJh10g-^k #y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y& #8 * #<,Z#@0#D& 13#F 2#GD6#H?l#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN #lP#pW int    M 8A eR O     Ap# n #  #0'KJ7 '  V  &dt oey# _kf # gKn^j Bpk# ol#t m^t Bpu# t%ty (wy .@ $ /y# w 0y# ) 1#Ly 2 Q@ { Bp|#pat}y#rep~y#WOWX ]h gy3K n AK i _j sys (sy-yy3Ki #<y:y(;new=yt=yr> P;OynQ !T hd"(#i #sepy$ d$ [%8 0% o% %} %@ =%q #opt %zfG%Z#rl$jyZ%y0%y% y%3K#fny&gWy'W()4*'W(+D ,t---.X.r 9/XO$'0X-0'PXrb000 0 0 0 . 0) ! 0,z ( 0y 0 y0_ !02 "0t V Chtg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' 0J7 '  V  &dY oec# _kf# g0n^j Bpk# ol# d Y md " Bp##key$c# )%a# &# '#  (1 *E `+E# ,# s -# K . Qt c# _k#֥hKƥKfmtU(fmtTcl<wcrvS`cN(M')OfOOO9optO>wPc"PchX^X* 5@E KXs!UXofX zn"""K 0"9 A"}\" c"2 ""t >"c?"[@c oCDSg-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ' # PJ7 '  V  &dy oen# _kf# gPn^j Bpk# ol#y mtw/S 0n# V1# _k2# 3S#  4# `5n#Y n\ij|OijdocSfdKD(JiL wMnAMnjQNNvNDYn Y !!"^|cpY!k'!tP#}$$$ $ $%9$F;$ /$2 "G CDD̚g-^k#y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN#lP#pW int   M 86 ZR D Z  Ml 6   Ap# n # #% 'aJ7 '  V  & d o ey# _k f# gan^ j Bp k# o l# mtty (wy .$ $ /y# w 0y# ) 1#Ly 25$/QY__cP5Dhyi4365AhiB3C/C5rD` (_sayM(syrj ަ(i3/: y yNy 35 :!t"jH#æf̚%j$(eQ%_kg&optgS%j g %2g?%gh%jhy%Ӧhy%i0'\()Y*h+ Y()Y*+{,5*?-; ,(M.MZ([)HZ*gT*q*}a**/Z'001)Z*Dz111 1 14 "1A #1hx &1w '1,z (1Rx )1y 1 1 y12 "1O1xPCx̚g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int  M 8+ OR 93    Ap# n # # { %   t  '3a FJ7 '  V  &do oen# _kf# gFn^j Bpk# ol# z o mz +tpidexnL̚(KsigMZbM8MWM0M6pNnWoNn_pidOP,Zt < Cܝ. int  M R/J7 '  V  &d oeu# _kf6# gn^j/ Bpk/# ol5# m; `t T6ܝ (SFI retULg.-V6ߔCŨܝ g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '  6J7 '  V  &d_ oec# _kf# g6n^j Bpk# ol# j _ mj + ct/Q__cP:"ܝ4ind !X!.MqL_kpkirretsdtcttcd8indacbccie{:cܠa9c+ind;>;T;gi<oܠ]argcͨiv0(u _kwy w w wZixh yc wycm [c  ! ܢ"#D\"0| c) Tdir< j U |O Q  cn tt T)ܧ (( i* &+l_k,5 -S .c $dirc%aܧ ? &(k '^p' c'c(topc"(j@'_k'اX(num)* ["+%+ħ+,, TC  g-^k###5# %#<#{##@ # #$ #( #,"~#0$#4Y&#8 *#<,#@0#D& 1(#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN#lP#pW int   M 869=O 1! O R D  RHD  x # ! w zH {# |# 6h %@ J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#` ~ Ap~# n # #G% @ 'J7 '  V   # .?z $h )#  *# +# 1s .& d o e# _k f# gn^ j Bp k# o l# mH2W w {S # x!# O !# ("#s"ind&# '# Bp(# (#w?<?< R# S# jT# U~# ?X# Ҭ[# \#LLLL @]LwLtRl]!0"u4}- {S.# V/#z0>0 8][cpPƩr8dSd̬~cp]%P v̬!!"  # # S$; %c&]%'p %p(ret(len)N# *(O+.V+,iu,nr++^,eof,opt+q9+m_+ҩ+M+,-raw~++ [+2+i@,fd.f~.H\,c-+$++R* +HY .C~,e!,t|!,t1"-tsbS~,varR"+ "+"+[#/l$0 @[b 1$ 2`[3. #0; [ 1M 2[4W 4c 5>1 16al$5 7sk<$.*eh.fW h.gl put1xߩ|[888   98] 8gr8s8Z882"8:9C:ui 8 CEaC int  M R/J7 '  V   # 6 ,?  x # K , z$Y )# *6# +# 1d t ,&d oeu# _kf6# gtn^j Bpk# ol# mt86O$!(7z$gYc06 306 CCDg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' 6J7 '  V  &d_ oec# _kf# g6n^j Bpk# ol# j _ mj + cc ?V ?V  Rc#  Sc# j Tc#  U# ? X# Ҭ [#  \#fff L @wffct  ll ]  ?c5 c# Q# # n5# ;#  r`]mqc$6`]G$E$˪Fc$8X%61%˪7cD%W}XW%;{%˪|c%1Wl%U%˪Vc&)Xl;&E(f&&wYX&opt'L'cu'\var'tem'tc'd'(cS(Ehq(iUת(ip(8v(  r(+ c)!iU"<)# O)vn)˪c)iU ) c) c *ת v|p2* Q* co*var*#F)p*H ret**i+*$ͫ] c*%+ C+ܪa+ r++%i+t& ACD+ (B,D:,<Dn,+D D,argEc-sF ]'8\ ˪cL-optj-( P\Jh\) -  !on i*c!off i+++ Z D ,+lL )9 +$F ,+ 1+}L 2+ +2 "-~ +)!+4"+t 5+5+y7+ :  .K ҝCFD<g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '   @J7 '  V   ? f  Q   ! k    XA 0  4  e  a &dI oec# _kf# g n^j} Bpk}# ol# T I mT{ |j}~ Bp# 5 # _k# @# # c#   %For ukUIfCO! z&   m  _k# $# ݃# s # m" # ck _k# $# oՃ# {*ք # &\ _k#-n" #m" # q  _k# -n" #0" #" # X0C k# " # m" # 5# N_k)#$*#W+s #F--0# IE_k2#$3#4#5" # m6c# !k<#=" # 5z _k# $# # s # m" # 'i _k#$#exps # ^& _k #$!#{S"#op## Qg$& #$& # g _k# $# %s # -ns # s # m" # ,   _kA#B" #   {S# _k# $# F-0# 6#   #m Bpm # js # m" # _k# ( f ( y + s ޕ    ?5  ?5  Rc#  Sc# j Tc#  Uw # ? X} # Ҭ [#  \#E E E  L @V E p E c t  K l ]    D- c-.-.var K.tv .c.$. var" /#%/#C/_k%`x%ca/i&/Ȭz / xc/y/var{ /o 0(ms B0n0n0 varp 0!qqT1"q[!7q1"qd!q1!~-q1 optq1!(@r2!sc[2!Dus 2!us 2 wv2#!) 3$i%^]8(]s A3%ݬI]b(Hs T3&&&2 "s &t )&C*&[+c&0, Cdp int  M R/J7 '  V  &d oeu# _kf6# gn^j/ Bpk/# ol5# m; `t V76pg3 (6F3 P8L396 :FuןϯYUFl.64E֠C~p int  M R/J7 '  V  &d oeu# _kf6# gn^j/ Bpk/# ol5# m; 6W t i6pH4(hFg4j j64jku4Seku4X!56X6269 A62"Fu6: t J6 "N6$e١Cmx int  M R/&doeu#_kf6# g{n^jBpk#ol# mut {6xL5[ (zw5 |5 }65 j }65 [uuzC̭x$+g-^k#y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN#lP#pW int  M 8+ OR 9 O0O    Ap# n # #  %     'JF Ga# /Hl#&dA oey# _kf# gn^ju Bpku# ol{# L A mL h5  4(31H  ~0 # 4 # 6 O# (2 O# 4 O# - O# F0 O# Z6 O#$ 5 O#( 4 O#, O6 O#0 0 O#4 - O#8 - O#< 3 O#@ 4 O#Dt/Q__cP<x$5c(;6<>ǭ>~IK8MQ\OţC$c$H}g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9  u    Ap# n # # | % u'&d oec# _kf# gn^jB BpkB# olH#   m Nt"$L/6iZ6tcWpcx6snc6(Yj iYLH6(XY6ԭZ7Zg7j Z7optZ7\ xc:8yy8sigy8y\u\ 9!!!Zc"!6:!2 "Y!t T jCeH,Cg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9 +   Ap# n # # { %   t  ' ;J7 '  V   ? f  Q   ! k    XA0  4  e  a &dD oec# _kf# gn^jx Bpkx# ol~# O D mO{ |j}~~ Bp# 5 # _k# ;# # c#    ForufUIf>O u!   m _k# $# ~# n # m # cf _k# $# o~# {* # !\ _k#-n #m # l  _k# -n #0 # # X0> k#  # m # 5# N_k)#$*#W+n #F--+# DE_k2#$3#4~#5 # m6c# k<#= # 5u _k# $# ~# n # m # "i _k#$#expn # {^! _k #$!#{S"#op#~# Qg$! #$! # g _k# $# %n # -nn # n # m # '   _kA#B #   {S# _k# $# F-+# 1#   #h Bph # jn # m # _k# # f # t i ?  ?  Rc#  Sc# j Tc#  UL # ? XR # Ҭ [#  \#    L @+  E  c t   l ] X o   c#  c# _k # i TH 9v c?90]9iWi+9f9allXS`c:xcz:8c :ov f;4j c  6n,;R (mn <0o[<Co<opto<pn <!]< ~c+=<l""<l"R "h #]iI= X $%%%2 "n % M%t M DCK,g-^k###5# %#<#{##@ # #$ #( #,"#0$#4Y&#8 *#<,e#@0#D& 1#F 2#GD6#H?w#P: H#XA I#\H J#`O K#dV L#hqN#lP #pW int  M 8+92  pR 9!D CZ RO   Ap# n # #  %     ' rJ7 '  V  &d oe# _kf# grn^j Bpk# ol#   m ֮"e5{z}TD lկ ! ٰ  " Ne# ce#tx juid k# ` k#gid l#  l# m# d n# iF o#^ # p# # lď# 8ŏ#zcmd#arg#i̯,p]optr=iQ]Ϯ\ enϮmF\ǮEįE%HpHpΰϮDpfp=Sind=Ǯ=į=e>pP\ n zX>!7+"0]#C@#O$k>>e>>?  ?%r&iǮeįeA 'cmdr&optg-ee@ee()A h ( )A h ))A h  G * 'inder p&val e+WD? (p?,s ?,c!@!r!F@,opt!@!HA-H]fW "`] |A A A.]0$/ B "]0<0H TIB0` lB xB0 B.L h^v j /^ >C"^#  C ^ 1 l* 1 *  1x1 b %R 222 r2 22 "өCLg g-^k#~#~#5~# %~#<~#{~#~#@ ~# ~#$ ~#( ~#,"#0$#4Y&#8 *#<,_#@0#D& 1-#F 2#GD6#H?q#P: H|#XA I|#\H J|#`O K|#dV L#hqN#lP#pW   int  M 8; jR I   HT   Ap# n # #  %   ' VJ7 '  V  &d oe~# _kf# gVn^j Bpk# ol#   m tc,QD_r~pDDwhoUopDTDDcs~T,@Eum1El:hdiDE '(&um((,L@mE(KEMVoptME@M7F MUYNvFLv^ !F"""2"|C0  int  M R36/3dux # K , 6` # 6 ,? z$( )#*6# +# 13 C , &dloe#_kf6# gC n^jBpk#ol#wl mwtwR60FF(Q GMS64GmS6gTG^pid|w}G~Gg r62 "9M>6hN@(4C˱0\ g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '&d oec# _kf# gn^j6 Bpk6# ol<#    m  B+ cS ? ?  Rc#  Sc# j Tc#  U+# ? X1# Ҭ [#  \# zL @ $cdt o l ]z 7[0P]mܱZPcPHbc>Hbc\HvdBzH[^ret%inձ[kcctcWMv^ k  { ,\Hh(+MHav-^Hac. Iret.+I_?I _!I!I!'J!PJ!J"V"@!%J!0J!;J _!EIK!PK### c# -#D 2# 6# 9 c$#ן #Y UM#2 "M xCz\g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' 0J7 '  V  &dY oec# _kf# g0n^j Bpk# ol# d Y md   ct0n p  qc# r# ns # \d]βd]QrKULr0Lj(NLryL޲lLcLiU#lL!s"c M,((Mr)GM(*M+Ml-Tind.Mױ.VF(]DcMvalE*N_kESNSqN[(QN_kRNlTNiUNvalU)OױUhOs  O cO OiOX P Pc6PrIPwlUrTPgPCretWniU C!(!_klval"ױ !r!(!l"ױ A!r!_k xI!rw!_kwvalyiy#ePX $(P%optP&_kfQ&ױQ'(()Q*++,C_ (a(U-_+m.wR+,`) ((/ `(&)xR-@`.2R+>01l y !0t p1i 2on Dr1c2off Hr333a3Y313YB32 "33l>3w?3V?3'@3 @3 A3ONB3C32C3D3E3F3I3WyM3hxM3xN3FxR3 zR3c?R3ۀS3T3|Y3]c:Cɴ~g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D 6=   Ap# n # #%  ' 1V#9#Q k /#  B# #!1" J7 '  V  & d o en# _k f# gn^ j Bp k# o l# mnt3"t}_!->[_!->/Q__cPon]retpnRR,chReTSfn:ScpnXS9VvSpnS cS>T|(TsnGTгt|peT.rettTepnTE``pdXz|p U\ret}t5ULn}UstrInU/JnUBKU lenMUMVش,nl Vbuf*n?Vk+]V-{V*l V^fmt%nV&nWlen'W(WQ) X.-Xnc.wXҴ.Xi.Xfw/Xpr/RY!`  b^V"!`4 b^V`#` b^V" n$³bretc$n n%len9VV retnrnsnc$1 retepn&$:[ ret:epn' Y (('Y)chLZ*Z*QZ*6[*Ln[+ɳ+(*[+0n+n)fmtn\+Ԅn!`R b^U" 8 !a b^U"< L !0a? fn^p!__ppC`!a bnkanwa, a #a- .$ a}b#@bbn=bnwub!pb fnbp:b,1 b #b-C .O c#(cbn[dnwd!`c pjn4e#c bmnLnwm]e!c pnexpnfr/p pa,nccO #d.f# d bdnL nwd\!8d pngxpn"hri`d#d.j---.k!d varsn^k!e fnBlpZlpptl!0en bnmnw%n#PebnYnnwn#xe b^U"H\0S'0q000n0n00ڳ1twt0n0m222 n22 "'߳C/ !g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ';J7 '  V  nt޴0nq;nu0 !or-osKotiocvo vno n8An B&n5DG,M0P  $C+ ! % int  M R/&doeu#_kf6# g{n^jBpk#ol# mt 8 !H!] >36H! %2p (1Qp R2up c46p cp5up 66U )I74/,sp%6 %+ 'u,6(646)6(6_,2-06 CF %5ng-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '  6J7 '  V  &d_ oec# _kf# g6n^j Bpk# ol# j _ mj  c"  Bp# #key$c# )%a# &# '#  ( tD b(#M#/#@'(  < #  # - # ͑ c# W !c#  "c#  #c# bB $c#  %c# u &c#$ 'n bi JO TKc# L# ٵM#mkx lc# m#ici\{zci| %)q(Bqpp`qrpqqoptqind(rgrnW2hxe r!e"#e$X!0f" % )-r&(r'ױ!s'n"bs'2"s(cs# t(sl$4t'o%c]t'j%{t )S-$-]*v$-L2t +cmdct+cst'n u'2_u(xc}u,L2T2]L&u-cs-cmdc./(-l-cs-ret.8u/(t-lv-retw%%T25u &($u'&u' &Xv' &v'ױ&v'n'^w'2'w(cs(w0L2P3F 1^!pf"j2tw"3fQ1!f""ϵHcHcԵHcNHc Hc$Hc(OHc, : jNK t4* O` )nq t4P 555 c52 "AC58 intJ/  M R/k " Bp## key$# )%# &%# '6# ( 1 *? `+?# ,6# s -6#E. <! "# 7#6# _k$6# up%# 9&# 8'#VK0(V?G ?G R# S# jT# U# ?X# Ҭ[6# \6# WW WL @h W W t]l]656wD&x¶666Dx6DoxDx6xvarxvsk66P7xstriyvarlFymmn6{4P7|8dy3Dyvar5yfiJ6lenJ6z_|88]^Dy/0J:&B>C88g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9  J ڷ       L  Ļ i   [ :       m s  } D l ; ! " # 1$ % L& ' 8( ) W* + , ػ- . n/ [0 1 2 ׾3 ܼ4 e5 6 7 :8 g9 : ; 5< ̺< T= > l? M  ,  !  { > " K _ ] { o 6 C p m b   & \ ߶ V  ̷ ' } Ͻ 4 5 } > ` E  *  -   & ÿ      غ '     ݽ I  y '  L 4  P  п }  0  ~  g   ̼ ]   M   ] ָ   l    V y i M  й  _  ^ A   ɶ    5 C  v   Ap# n # #  % .'tAO88 zfDO888)z<6'C88 10g-^k #n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y& #8 * #<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN #lP#pW int  M 86 ZR D    Ap# n #  # { 0   t  '% 88]zf$Hz&n %C89!W0 int  M R:krt:89[zi7zbuf8zlen9%z%9@9z5i"zbuf#{len$%0{C@99C{yiBn{ pDT FgDyc : 7.99{i-{ p/T Fg/b : 7FC9t;!W0 int  M 8kR yWA: ZWnt99]}9L:{  fd|A{ off~ rA AL::|k fd>A&| buf?D| len@%b| rBT CAU ,::| fd)A| buf*| len+%| r-T _:t;} fd]A$} cp^B}nr``}:7 FgX4 \Y% Y%C4t;x?" int  M RMDO%M% O<1M #M!#L"#/O## aN$u#N%#O&#4L'#8u# , \Mt;;]M fd[6}  n6;;]~ ttpmM} v6;<] ttpM} Y6<8<] ttpM} h68<P<] ttpM}  6P<x<~.ttp M3~  86x<<]g fd66Q~ ttp7Md~ E6<=~tt6=|=~ttN6|==~ttܖ<6=t>tt*6t>>2EttP>4?^ (64?8?] fd&6} ttp'MF8?x?!!"6CIx?0A#g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ',! X\#_!#Jb!#Se# jn#p#s#ty###)###e#0*##Z66eW  {S L# x!A# O !A# ("#s"ind&A# 'n# Bp(# (#V#e ?z ?z  Rn#  Sn# j Tn#  U# ? X# Ҭ [#  \# L @nAtl ] 1x?0A.w/ _k0*82j3Sb4q67À 89n>:j < **2*0C0AC\%g-^k###5# %#<#{##@ # #$ #( #,"+#0$1#4Y&#8 *#<,#@0#D& 1(#F 27#GD6G#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPM#pW int   M 869=O 1! O R D  RHD  + Ap+# n 1# #% G ]'Cp Rew z {# |# h % J &Z# : '# +{# -# .# { /e# t 0p#  1Z# A 2#( M 6#0 V 8#8 a =#@  Fs#H  Gs#P  Hs#X X#`tx juid kh# ` kh#gid l]#  l]# m# d n# iF o#;;T0AA, RW5S;TAhA."AA mHfp."@} ?EEE}h ELEEE}h EEEE}h E  rstAC Ձr  gɎ!'"BB9##BB## "dBBe#M#XdBB#d#oLC`C##(LC`C#4#?0g$Hg%&1&1& rCCD&' int  M R%u.=:#&#/ , /6CD: fd.6e rv16 l2p sa3dC DE'g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9 i   Ap# n # #  %     '+  .:T  # &T# d  +k  # #t # # C t# !d# "c# ## j MJ7 '  V  tNWcfctyp\WcfctypsejresO'DEx &cnp(c؂s(ct(cfd)Tpg6~rfg g!H!"D!у!!&##CEHf)10g-^k ###5# %#<#{##@ # #$ #( #,"#0$#4Y& #8 * #<,O#@0#D& 1(#F 2#GD6#H?a#P: H#XA I#\H J#`O K#dV L#hqN #lP#pW int  M 86 ZR D Z0Z  MlJF Gl# /Hw#   Ap# n #  #  0    . 'y!rE(FZrd ryt1 rQt2 r (4r(FhFd3rt13rQt23rфjD hFG'rtCrutCr.stCrAt1EPt2EiF TRlGxH~wtvpirspjwsfpk}΅m    DxHHfptvpr5wtbZVB 3 p %2CH|J+ intJ/  M R/tEH|JS CD~ dirCD_kD6 F6 F6 retG- ]Gl G rG߇ sGbC|J|Mv+g-^k###5# %#<#{##@ # #$ #( #,"A#0$G#4Y&#8 *#<,#@0#D& 1(#F 2M#GD6]#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPc#pW int   M 869=O 1! O R D  RHDw z {# |#h% J &Z# : '# +{# -# .# {/e# t0p# 1Z# A 2#( M6#0 V8#8 a=#@ F#H G#P H#X X#`  A ApA# n G# # % ] s'tM|JJ&  LRlNpsbOzJJSkJ|M i_kjl!j mXpmAqm>mʉmn'nE hcePhcGGCW|MdR=-g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t 't8 5nbuf6n 7KNn|MtQ Ln_kM]O_hOֿj PnXpPnpqPn<PnbPn%BPnQÌ4Q Q]Ohh ,(ntQdR)"Hn|nwdn  CdR,V.10g-^k ###5# %#<#{##@ # #$ #( #,"#0$#4Y& #8 * #<,#@0#D& 13#F 2#GD6#H?#P: H#XA I#\H J#`O K#dV L#hqN #lP #pW int    M 8A9HZ 1, Z R O3   RHO3dw z7 {# |#h %$ J &e# : '# +# -# .# { /p# t 0{#  1e# A 2#( M 6#0 V 8#8 a =#@  F#H  G#P  H#X X#`   #         / 0 v     p U   Ap# n #  #0'tF<;ZdRdS{_kY  [@(h_ dSTt _k ȎjWppYfd  [kTU.kY_k lfd UfpkT%M 7oU,VBmԏ_kn jpWpppZsbq7~rr r [qhJ58%6 <e7 D8,@   M90i?C@,V]0g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' &d oec# _kf# gn^j< Bpk<# olB#   m H coctD (Y#M#/#@v|_,VtV sl /8MiT  <!StVV]nsl k  ("S  VW(Sڐip4ret  R plen W8W]!sl 8WWcsl ɑciT WYsl 0cNcQђ wo!i6!tcTlYYrEslj skc!rm“`YYmsl_ QVY$ZslU <_* $ZZZn)!ret+ !i,̔n Z[Tm1 m2 >sl Z!i\!nzl1Yl2[3{ [x\slz new| X!i}ו$C x\\slA nB3!iDg \]Rm1 m2 !iD!nbtt"".Cf]a2g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9        Ap#n ##  % '&d$oec#_kf# gn^jXBpkX#ol^# / $ m/ d^tBpu# u ct7]]]W6i8ϗYB]$^ WAiCO$^@^6WN>o@^8_\WЖΘ(ow^ i>\'8_@_]n&z@_`W(o֙ipi(FWWM``dWilenretW``W֚``]1s1s2j hZ`a-WYLYcji[Uj[x\cr/aa]W-.dC ad4g-^k#y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"2#0$8#4Y&#8 *#<,Z#@0#D& 1#F 2>#GD6N#H?l#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN#lPT#pW int  M 8+92 D eR 9   O# ,l#  # yS!# "#  DIR 2 Ap2# n 8# #  % N   d '$odirlyumy2nyfdpdpq'rxr  >_curynewy*F7Aadě<E?yY@y9opByYnpBy[pByuC<_2C<ֿdh\uh !!"(i#V$v M%&8&8yCdTl6g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t 'df]nsn_nftgqncRj n^rn<snntgiZnycj nrnsnnijޞ2n c=j nUrnPsnMinjknsgh_khʟrjnretjnkJnkk$InOcKQj LnmrLn\sLn,nkTlS+nc-j .nȠr.n\s.n xDmC#Tlt7g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #% z '1F#9#Q k /#  B# #!1"tk__cTllscTnlXo/=strnN_kwtrnretnsnlZc.5nXo4tO3nnlen4_k494t4tۢc6 6sret7nӣr7ns7nHiM`i_n4ttnԄ end tI! nV"tng#len $ %%CStx9g-^k###5# %#<#{##@ # #$ #( #,"+#0$1#4Y&#8 *#<,#@0#D& 1(#F 27#GD6G#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPM#pW int   M 869=O 1! O R D  RHD  + Ap+# n 1# #% G ]' Mw z {# |#h%~ J &Z# : '# +{# -# .# {/e# t0p# 1Z# A 2#( M6#0 V8#8 a=#@ Fh#H Gh#P Hh#X X#`   # , #  # yS !#  "# DIR J:tx 8ӥst97<~j<~dd=fn>Adir? ?~i@_l@zaA]QbA]֦ttF xi`$uufBuvl` w0w~>;^;@~  1 1g`Cqx(|;W0 int  M R:J7 '  V  |Zx(|! uiUVL >VAj bufW lenX% _kYAϧ p[ \Af si]y}C(|$=W0 int  M R:krJ7 '  V  Z(|$è uiU >VA bufWԩ lenX% _kYA p[Ъ \A0 si]PC$̀R>W0 RVT0XViff O P# Y7# int%Zp'e  i  M R i\%3__sZ__nZ%?Z3 ,$̀s&c&pos.5Z/`0%S&0%q>&C̀()? int  M RW6/Wnu,6̀(fd*6Ƭofd*6fn+. nr-A ױ.6j Fg/~ / ,C(́?g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9  # #  # !#   Ap# n # #  %     '@(́>rp?ƭcp?winBihttyC  NM5Ć@W0 intU:  M 8v9} 001a 00R  RH:34>w z_ {# |#  # ,#  H# yS!Z# "# : 7 DIR h% J &# : 'H# +# -# .# {/# t0# 1# A 2H#( M6#0 V8#8 a=#@ F6#H G6#P H6#X X#`AOMAOḾ+bufFUF%s$ROROS%T+T+GU ]U   V^.W XԴkY%stZ~t[A9y0eihNifeAimilen%<jydz\V{+O| 4}:@~ATXjnewxj)j\*8Hj %Hjnewɻk=A) ܇eA])N,w :!7_ : 7DCCW0 int  M R:)Afd&Abuf'μnb(% n*A i*A> nt*AWC4̞ % N O 1H#9#Q k /#  B# #!1"} -q {S .# V /q#z 0HI = w >wG 7;΂ڄ2 :' Bp ;'# Ԅ < #end < # =  =y# ># ? '8 ) #end * #X  + # ,y#  - #ul .#H /y# 2 # 3 #  4#$ 7q#( 8 #, 9 #0 : #4inf ;#8 <#<, = #@ >y#D A #Hb B #LY K#P- ?ty (wy . $ /y# w 0y# ) 1#Ly 2? af _k b # c # j d # e# g# ; h # if# j #$ k5܊]6=܊] Prsp~8p PspνD,, cxtE,l!C jmapBB"PD[##>.#@m  U$j0k%~,&tpk'Sj  keyi (kk P)xU]3 cxtT,*[8оZ cxt\, 8T key map,+f ,r - +.y-8qI,cxt,/t- 0 Th]J key map'\ h rY  mapZ^key[ +f[ ,m].{S^  nt^ -8_q.,nf_qb/t-l u| DM cxt{,.} ,r} 1D| |h0 ,c [.m (lk t" t" p#yhH eof~ - y.*TH"D -UyM  vs +H2X+y eof, 3>  eof -y ̞# +H,-.y$s kA4k5 $ k/4k6 7 x7>y|888~ E8 F8X F8 B9(hH9j L9m P9  9~u X9x \9y,9yX9 79 79 79w 79 D9y} 79~ 9 `9ćq9k}H9 9%$97 <9 @: -3:~ /G:G 03979 T9 499 7: Fy:# K :D R : E n:B~ sy9 \9 d9 09 (9 89R,`: i :w jy9\ L9 P9j l; l; p;  h; t9Xy7;2%d9qT9079q79 9 h9v86:v  :3  :  :  :  9_7 C ̞hhIg-^ka###5# %#<#{##@ # #$ #( #,".#0$4#4Y&a#8 *a#<,#@0~#D& 1#F 2:#GD6J#H?#P: H#XA I#\H J#`O K#dV L#hqNa#lPP#pW XFR"TX" 52 2  Oa Pa# Y#int%Z<'eh5  M 8 R 5a . Ap.# n 4# a#% 5J 2 5` 2'0kaaa 1#9#Q k /#  B# #!1"}- {S.5# V/#`z0I=! 22>= G 7h;΂ڄ2 : Bp ;# Ԅ C#h ?h 5 2 p  qa#i1 ra#i2 ra# tW v-a== ̞ ]dia L] Lt]keya8#aQaRatLK aj ka}VaL6 a kaaTu a  ka(!aT|] aF"keyaQ#|Ykeyax$#a$a!a]"%ca& aO'cha0!!aأ] ad%keya(aأ] )=&nad'choa!ad]" a%keya(aȤ]N )=,2aȤ? 1a^%key1a|'i3a!pya] xa%cxaza1 a%keya'ia/'saXHavp a%keya&Nah %mb Ba&)caU*hD $ac+PR  %keyQa,8SaTEfa PX ea%keyea-$XaPب.Oب88n+a8,W@ k*av%key*a/,a,0,aV'pos,a0tmp,a0pre,a1' 'bqag2Ъ'bYaa, a%keya,T,a&a$ )=>9a$\ a%keya!a]M a%keyaIaЭ Ha%keyHaxaЭ# waN%keywal3Ayaa& a%keya'enda4a|z a.%caL%mb0paa|4 a %keya)'caR)mb`&ba4p )=)caV)mb`0a\ /a k/a aȴ a@ ka^5k/ a|aȴ4 a kaka4/ a,%keyaJja0~n ia%keyia1a0̷ a&%keyaD6 a̷bca6a$aca7raT86aF0ca0ra8ao9ca0keyaJqa4}f%keypa p'cra/=raP/san:(l!5@l;1;;b?l50ta1O3a2ؼܼ3a7Za4 Ya%keyYa'c[aE,=[aV%a@Y4 $a%key$a'c&a/j&a23<aza@| s a?%keya]~ a|d{  a%key a'c afad  ea8%keyeaVzoai> na%keynaBa} Aa%keyAa@aAa0wc0mb3Ba0pa0pss 5 2a a@ ka^'caq0pa1 R3%a1|l3#aB}C5l>D;>DLa a%ca+>?%up])lenaT,ԄaV0endaE{a a%keya&`a@ k_a%key_a'*Ea@,E kDap%keyDat-a,Q ,a%key,aWa4 a_%keyafa$ a%ca/a 6a$d+$aVkeyatFEadh]S$akeyaG$EaGHuxG~L2GOaGYTaGUGVaGXa|GYaGDZaG\GW]aGfaaGcaGeaG9hux ax 2G kh,a,,a0H4H4H aHFHXFH BI aI I aI aI aI~ aI aHy aH aI8 X"I Y=I iaI 2I aJBaxFChHPg-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t '0  EO F# VG #H&*hV pi3pH\j ZyWiY`44158 O:zQ;K *><37O97}CHRg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '0}-" {S.# V/"# z0I=> (O>Z (Hmap~Oi9Oi:;OP{dOtieRfOPlROt&AmapQOEiS TOc~!3<3T3 :3X "3 C\Sg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' c0N  G77;΂ڄ2: Bp;# Ԅ<#end<# = =c# ># 7?7 ty(ay . $/c# w0c# )1#Ly2 h /B {S 0# ӣ 1# y 3c# v 4# 5#  7# 8c# 9# :# C <#$ N =#(  >#, ?#0 _ @c#4 5 B#8 % D#<  E#@ G#Dmb IB#H  Lc#X U M#\  N#` Pc#d R  Qu,scpostdirt'retvEoldvnD[,Zndir Wret%N 0pa/k/ Xpk/TcZdir!pos! 0'Rkeye"r 0pkey"r1pcxt R OcxtGce#@5|cxt4&Dcxtcrv   cxtcr$< %dir&$'cxt'pcha 4 dir_-$`Kcxtbtccrc( me) ) *(m+' ,2 -4H] key+-oH\]K >keyQ.r?cH.@L._BcD. DP.*ET.FcX.G\/// /B0 0~0c0000ć 0-f  1^8@/: C\d{V10g-^k #n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y& #8 * #<,O#@0#D& 1(#F 2 #GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN #lP#pW int  M 86 ZR D   x # !  t&   Ap# n #  #  0    / 't # #  # !#M O M  O<  1M # M !# L "# /O ## aN $t# N %# O &#4 L '#8 t" h ? @# A# 4 B# ( C# D# E# F# G# H# I# J# z K# L# M# W N# N O# P" 0% :   % N O} - {S .# V /# z 0VI =  > 8\]#{d!K|#wsc} 8~uc  b0S ]# 6tty a!K#; Xr ) Xx4tty' !K(# q x ~tty K!K#i   tty !w/r  tty !K#"hm #$m%h&h ^9'0(tty hl]W' lj& key& -,    key - )i )P\+*!\Vn +tty T,  -!K#,F -D -E-!KE#*d=  tty +tio.n m #| " m# / ~# 0Cd0C0J d0E h0hl0|''x'v'V `111 F2  2~  2 :2% :3~4\  K3G5t  @1 2 22 23 dCFdP Y10g-^kl#h#h#5h# %h#<h#{h#h#@ h# h#$ h#( h#,"#0$#4Y&l#8 *l#<,(#@0#D& 1#F 2#GD6#H?:#P: HP#XA IP#\H JP#`O KP#dV L#hqNl#lP#pW XFR-TX- @= =  Ol Pl# Y#int%ZG'es@  M 89 1  3R  3R3H@w z {E# |3#h % J &# : '# +# -# .# { /# t 0#  1# A 2#( M 6:#0 V 8R#8 a =]#@  Fn#H  Gn#P  Hn#X X#`ll  Ap# n # l#0 @ = @ ='n 3 4h# 5 5h# a 6# 7#  8h# e 9h# @ :h#   # , :#  # yS !#  "# @ =DIRh 0 l ll9v 3+h@l"u 4Kelliu 6phhlhz 7hhlTu 9l ;ll%w Fl hlF{ L S"h1#9#Q k /#  B# #!1"Mll}ld] |!@ ="1|lP#h@,$shW lu$qcph%rhU&vQ jP'iRl#cl  jl: = Y(ilx(c1l(c2l(sil@(lowl)h(vl%ps1~H%ps2~@(wc1(wc2<* +S~*$4 ,6l-4D,7l.> j,h'il'jl,7l,@,>/ ,,0,,#l,h   ul'th+jV):)dl(il1 n2 3n4+ *47 U5A 5K 6W W5c * 5 5 -5t 5 #h, h l$qch,Vl,l+hP!  h, ԄlJ lh$qch+hV%oqc@W#8l = h nl l" ElV+D?-d)jh)l(sl+5~7P 227o 22822#l1 j]+5822#hh{0 "h) h(xh9ghhL 1 = e5 Zfl) mh!,nl)o1*)l*)l+h++jih+Łjh+kh+%ll9o*hLj = ( Z)l)1h+ˆ.h+/%++0l+30l+T}0l9rLW =  uW6+lY+V+jlU+hW #!LT = hs Ԅl$endl -W l l)j6#!ltTZ jh+5)*Xl'rl1`n22.2llk,ml'sn'psp~'endq,r,sl'wsl'wct0,l#lt h dh+lX)l.)lb,l(sh(c@)`h(dnh1Zxn2l3n5x46H4:4c456l-49#ldb9 l(cl#Glds l %ilT&Y'A jS$lenlr$maxl)l+ld)l)l#(ilY(jlx(kl(ll, h. 9l8,:l'pos:l'ps<~,Qg=l'w=l,K>'wc?!Qf jP(lenRl<%maxRl[%iRlZ) Sh1Ank:S3o5_5k6wL4444=90@Q$fp/|$dp/)1l%end1lV)1l)n1l8)1la,o1l) 2@)2h9Bl Al" kAlA)-CW)uDl)Dl+Fh+jG+Hl+Il+Jl+Jl+ K@+nLl;,cj)8*l l>~l>h>l>l>ć>%?uW`@t?ud@? Eܐ?B~hp?Rt?Gx?ߐ?|?{?pT ?vX?z_@?|l@Mvl@ive@z3@"L?lh?ll?l@k+l@'l@4l8@8l7@]0l@mCl7?+l@Fl7?_l\?HlP= l?IlD?lH?l?WlL?l8?l8?l?Zl>6 fl>3 l> l"CCP >a10g-^k ###5# %#<#{##@ # #$ #( #,"6#0$<#4Y& #8 * #<,#@0#D& 13#F 2B#GD6R#H?#P: H#XA I#\H J#`O K#dV L#hqN #lPX#pW int    M 8A9HZ 1, Z R O  RHO  6 Ap6# n <#  #0 R h'w z {# |# h % J &e# : '# +# -# .# { /p# t 0{#  1e# A 2#( M 6#0 V 8#8 a =#@  Fh#H  Gh#P  Hh#X X#`  0   % 1,#9#Q k /#  B# #!1"} -U {S .# V /U#z 0,I =q [ >[ E  F# V GU# H 8N O#VP # H##_k #zT d #_k #n#H# ###map# ))t P  |keyr ;VsUYo|.  $ wkey VUmapj  U $ , ] key q , 8 ]Dkey mapɂ 8  8U> map҂Q!i ױ T"4U  Q #p$map#{S%i o%ic%&2  ]= $map''i (   ]d )mapP*  ]+ D ]* D  ],  E $msgp-J*  X #)-C  X: #  %i   .F L>h #Ei.1 L #0X  ].+S ( #R/*T # 0 X1 "(A E #` 2i T.c ~  #b 3d.Ar t  #q - t  # 2i U. ,6  #U 2i U-7,,s  $key6  48U%i9  %c9  5o /d  6 /d 6 6 3d 7,3d 73d -Ej,T  $seqis %retk %rk 'sk%cl  5po 4 T6 / d 6 3 p3 73 .  # %ret 48@ c#  k 'i %v "  P #  $key "]P:#Y%i w9Mb# J $mapK#L2keyN W4OU%outO\4oP Y(]#  z" # $key "U7P$seq6 %i9 R%c9 50p./N >6L/N r6f3N 6P3N 7483N 4t88%P'i& 4'V"d")#VU$map2key U4j [4i X4y \5Hpt/hp/M'i p/5p/ 74"8"3 6!!/ 6!!3 p/ :&d"t"]V#VUX: t;ztq1 q?f-O #&#'i 5Hqz/r `q'tem/V8.i &h&a##W""Uh&&#'i 8.&(#  F'i /7jd4Vxq3VU/5q%j$ q'j "_@ ((B#? m$key?  ( )7map8U"  ). $seq$#WB$len`%i ~%c  %l I/  6--3 6--3 7--3 .\ .D/n#'beg %end 3 %v;"R D/1%#{SN #O#)P$mapQ7/5SU/qT ~%iU 'kV[q'ucp%%icq "8 1x1#6#6#$map7A4/9U4k: d&J  x11]#_#V U}$map &| 11])VU$map" 1 2#2#UP#n/8U&-  22]#+#,U 2L2key Uv X L2p2!xkey LU_rv p22]VU:^ ]'i_ 3`3`@ 'i "v 2|:#3/'c %i %key  /  5r/> f!5 r%var!/1"%eZ"=HrV1pr?"644<4bf'flc =roA"r?"BB6663Z 67d83n /> @#6882seqofr%seq%t#%j& #'k& />& #@ ujWu353b3'i 3  C. X |:<$l#jV1$#W e$%iY $/Z$/Z$/$Z%'endZ3b[>sa1-1!8sD9~?E%BQ?]%?g%>s11-5 <D=&#4F&46W'e74:8 V48 U%r8 d&"= D==& #j<&"k+ ==&U#* '#k* '2r, Th =>&'eQ'VfUo'keyg 'U  X 4+4$4 (4 ,4O %4 04 4 V4JQh F }4X m d4#x   4.<  4 ̊ E<E<E <E~ EfE EfE EfE FfEX FfE J~  F~  G|}Fy  F~  Fk} F% HYJ 8F  F  E_ EH E E  U!GAE! x!Gh!FI \ F ] F ^ FW _ F ` F a F b FZ c F mFa u F\ { F | Fj } F ~ F  F  F  FX F2 %F F3  u C>K_jg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' c0N }-5 {S.# V/5# z0 >Q ;G7|;΂ڄ2: Bp;# Ԅ<#end<# = =c# >W# |?| ty (ay .( $ /c# w 0c# ) 1#Ly 2 9 (h / {S 0# ӣ 1# y 3c# v 4# 5#  7# 8c# 9# :# C <#$ N =#(  >#, ?#0 _ @c#4 5 B#8 % D#<  E#@ G#Dmb I#H  Lc#X U M#\  N#` Pc#d   Q?{>\>'cxty'_kz' |cxtX\>?(OcxtVG(rWe(sZ?|@(yc(( (c)%) gE|@@HC)pcxtCb)cD)!nF)"F*"9F$+"FM+#(JF!fG5+$G\G%j%l .@HH+cxt-+!c/+ =HH+cxt,%c!r7,&SHIJ,;{SRu,_kR,'cxtT(xw)'cxt'i33RjIK, *i,*i,!cxtk-%cl!rl-;soL+s,W-b2--k-.KK]F -key-.MKK] -key-/dKc@/5LD/N 0c111 2 2c2222-3  39c83;<2 F1>9pCKȌm10g-^k}###5# %#<#{##@ # #$ #( #,"J#0$P#4Y&}#8 *}#<,#@0#D& 1#F 2V#GD6f#H?#P: H#XA I#\H J#`O K#dV L#hqN}#lPl#p(+(W  XF R> T  X> QN N  O}P}#Y#int%ZX'eQ  M 8 R Q} JApJ#n P#}#0 Qf N  Q| N'(P%N 1#9#Q k /#  B# #!1"G 7;΂ڄ2 :nBp ;n#Ԅ <}#end <}#=  =#  ># ?t\__sZ__nZ?Z<U}KL]}L|L-  '.w}|LLE. LMp.. }MXN.y!ret/ }./ }."crXNN.#QNN]$FN O!/%E}@/&iG}T'7: O@O]%9}^/ j# @OpO|/("pOTP/^)to!}/#}/!i#} 0 X TPP+0PQV0%$}u0*len}!pmt0&pV+H }QR0)strF 0%ԄG }1)endG }D1!wcI x1&psJ L!tmpK }18K }1K }1!maxK }2,RRW ---.ORU12/pmt]2/lp{2/lip202/vlp21r(31retr31p3231l}31rl}42e}842x}d42}42}42}41ind}42>}+52n}I5MUUu5 )pmtL5*retN()UV59 )l(}5!i*}5(-VX6 )new}96%)W6!i}u6x} 7a}*7}S7(XZq7 3}4YZ7 fZ8[75c- t3U(8[\7s !t86 @t - 7Xt8 C}\\8Lh}\h^68 %Hga8!pi8*ti*cj}}h^X_8 90{:|9D^}X__9g )c]}>9)pos]}r9&uc_TB}_a9 )cA}9!nC}94``S}:;axb : %}K:*n}g}xb4d:v 3h}!ih}:!lh}:h}:"h}:i ;i);<] [\}col\}= 3i>*iq}< }>3$4d,u<;j)oldh;)new<%}P<%}<%}=%}R>!ofd>!ols8?!oe?!nfdE@!nls@!neFA }A}SB}B!od}kC!nd}D"}D}sEv} F?HL?ED}F}F@t!wcaG&ps}G]}0H!retH7t}SI@tD!gl}I6v t- - - @ u38 4kk8 6 8u/A I4spt8 (,uȌY~(\6Y<\aY<sigYm<YMBY [Y~!act} N Y"&4Y#sigZ$m<1Z$MBOZ>Y~%oh<g!4XmZ!>"Y~&oh#<Z%dV&,&,dXZ'ʐZlsig[(oh<6['vvT[sigu[!setx,~ `h al iYp iY iY iY DkY kY, kY knYD))* *~ /  *G 0  +#W+D[ *~ C̗zg-^k #z#z#5z# %z#<z#{z#z#@ z# z#$ z#( z#,"`#0$f#4Y& #8 * #<,[#@0#D& 14#F 2l#GD6|#H?m#P: Hx#XA Ix#\H Jx#`O Kx#dV L#hqN #lP#pW XFint !   M 8B fR P    x #-  # ?z$ )# * # +# 1" ` Ap`# n f#  # ) %| "' 1#9#Q k /#  B# #!1" z 0    \S ]EcS [FT ]pcT [azԒ[s`[xY Ԓ\cY 6\?V 4I\cV h\U 4d{\$cU \9X d\icX \X TW \cW  ]W TB ]s1A']s2A:]j F M]vJJz`]ps1]s2] i T!l !len zܔ]"8/ ]to ^#T T$3z ܔ@^H"k 6^key T^#Ԅ W%end r^&z^& z^%len ^')@^qlen  _ ~ '_"} R_key} e_(&e x_)Sw ]"v _keyv _hV d_5wcU_!cW J d̗_`cI `#Eq *f*f+  + z+  +  +ć + Fz* + ,D   Cx̗ȣq|g-^k#h#h#5h# %h#<h#{h#h#@ h# h#$ h#( h#,"#0$#4Y&#8 *#<,I#@0#D& 1"#F 2#GD6#H?[#P: Hf#XA If#\H Jf#`O Kf#dV L#hqN#lP#pW int  M 80 TR >     Ap# n # # u %  n ' h0 ty(fy .L $/h# w0h# )1 #Ly2 LS̗ԗ]numR7`.ԗȘJ`-i`k-`;-`/W`arg0hTi1`pos1VpȘ`oakeyo1aqvOa;qIrVstcu f]emakeafDa5akaZ DXa  bkey +bl n V_X>b = ]hib^bold`hbnew`hb Nab!؜iu cIcEtc= hW(ccdircomXopWr(@]ckeydX@X]!4dkey]dX`]^{dkd"&`d8/dtod#= hT&dekey.e_TLe>^kekey^e$`c`eo>The=ekey=f$?H,hf+5fk+Hf"[f fkeyf f"f^  gk4g RgТeg gkgrUnT"ТDg gkg h3Dȣ$hM Ohkxh$%> #A#D#nG&&'~'h''''~'ć' ?ICȣĨg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  'G7;΂ڄ2:Q Bp;Q# Ԅ<#end<# = =c# ># ? Wȣ ]{ShԄQendRrlb\ h  bTXԄYend[9hJ8 ikey8'i%HPi$oikey$iXkHЦi lb^lbiGLbЦi IjԄJ1jendJOj= Kcmj Mb`,j]jԄ^jend^j= _cj abP j,hk!&h-k:Xk Ԅwkendk"ȧ# cTb`kGbknewbUb`Ĩl(b1l(belnewbVbl$cbl%%&?b' '~'''&u9&<tC8Ĩ<hg-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  ' M BpN# Oc# 2P# @Ĩ  m;[ L7mdZcVmY LP] ctmPmmkmtmnk6ntTnAhnhnmnn{focg;o<Yocxo"?CcF|I T ~ lv Al--%} -\ {S .@# V /\#z 03 >xb1nl<`]vl`]VlokeykolHokeylolHl]ll]Tu lpol.pmlApkeyll`p!l,]cl~pl,T]lTp zf-p!j lpcq!lq"!`~"!`}"@"`tty'lCq# $__i,%P,& @$__i-%P-` GlVqtFlq"<HlT'rHlU(l)ttyl)teml*j l*l)kl* @*`*`*@+)__i*P,)__i*Plqeclq-v.v/q/"q/-Hr/8|r/Cr/Lr0W~0b}0mD#R11.Hw1}1s1lLr .l&smb/Zs B0lxs'i2lV'c2lU'ps3~XlLsa s ls"lW!_s'wc\'ps~T"~L2S&t cRlQtkeyTlot$tTl'iTlU"UV3Zl3fl3bfl  4=3Hg 5h667 l7w l7 l7 -8@V 8NX 6 l7 m !C,g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D   x # ! t  Ap# n # #%  'n0'<NGOT`Pkwn}- {S.# V/#z0w>G 7;΂ڄ2 :: Bp ;:# Ԅ <#end <# =  =n# ># ?@ #\ l?z $ )Q#  *# +# 1 lh / {S 0# ӣ 1# y 3n# v 4# 5#  7# 8n# 9# :# C <#$ N =#(  >#, ?#0 _ @n#4 5 BK#8 % D#<  E#@ G#Dmb I#H  Ln#X U M#\  N#` Pn#d  Q X? a _k b# c# j d# e# g# ; h# i# j#5$ k5 p  q#i1 r#i2 r# tW v]KargtttargPtcJP"u kMu $lnxu!eofmu"Vm#\n( .a,u7H_uM`7v`#E $$$ % % n%w % % -<%~ /I%G 0$R &82  &3$ % i% o< %# x*% ~% %^ < &JD78* , C/,d10g-^k #y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y& #8 * #<,Z#@0#D& 13#F 2#GD6#H?l#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN #lP#pW int    M 8A eR O     Ap# n #  #0  ': # #  # !#y0K `  %Nq} - {S .# V /#@z 0sI =  >kl#m:#X &] Q,X][0PPݡPQXĺ%vim Dvt mvĺ]on v?@] @лvs лvt |vBs wiu \wb |]mca zwel]jwk w>ywcap=w i? T!(xmap'#?A 5b 2 p  qa#i1 ra#i2 ra# tbW vaMd]aPma]#azkeyaQa]^azkeyaQ|a]hazhaQDa,]CazkPa,L]Oaz keyOa{!B XaL{ZWaA{ keyWa_{"|#tbar{$a<{%a{&keya{'w#enda{( a|!Ra<'|QaF| keyQao|!ap|a| dira|| lena}#posa0})incap*a+ap}a~a&~!aD~,RX(ab~! +a<~1*a~ key*a~!a<~pa keya0+aN) m!d aa keya(8!a!SlaG< kaf keyka(8mah a]y a keyaJa] Ia keyIa!ah- aX keyav-ca!]ahV aʁ keya-ca#pa+a<$w aP opa,ԄaV(Bpa)endaW(a-ca)ncaR#nopaȂ#wc#nwc)mbw *Ba)mpssL.@P\ (aZ"hx(a 5 2 a<D] a keyaʃaDL] a݃ keyaaLT]> a keya!] aTT)} aT keyag!O:aTz 9a c9a#ch;aʄ'w(Aa!a* ha1haD*a!)a(Wi (a key(a/( %= Ʌ݅%3a0lena$xatB%8/waa&towa1= y2zaT0izaц!~batd_aakaa"*Ԅca!ad5a` keya*a#c"Ld-la!1a0a= key0a[(2ay!4aZ~a key~aԈ!WadVa2 keyVaP$Rad%Q0iSa؉0lSa!ia`]ha? keyha](>k{#ila(z pa(bpa!,a`pҊ +a key+a&(-O(t -m( .a(&.a(w.aNj(.a,/ap!ap<da. keyaA,T*>a!ra<Tsqa cqa#isa݌(t(va,ww ([xa7,ysH.(av3xC)wcP#ret.t`)strsV,za  5 2!aӍa keya<*Aa#iaZ#lax!tal)a keyaalt]fa4 keyaG4RUatZTay)cVaU! xa4wa keywa5~ha4\])g(ia!n*a\D$~)aO c)am#i+a,-RX-k.aLaD`]Kaʐ cKa$1 a`%= %%ԄaC&endaa6naT, gR ,>ha )psis 7.7.7 a7BL8 a8~a8a88a8a8a8wa8~a8-Z8:a7 a7 a7 a88 XM8 Y8 ga8 ia8a ua8& va8X 8u a8 aC mg-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t ';J7 '  V   SnavR Tn d hnthn; xkL@xU~ C g-^k#c#c#5c# %c#<c#{c#c#@ c# c#$ c#( c#,"#0$#4Y&#8 *#<,D#@0#D& 1#F 2#GD6#H?V#P: Ha#XA Ia#\H Ja#`O Ka#dV L#hqN#lP#pW int  M 8+ OR 9    Ap# n # # p %   i  '0N}-/ {S.# V//# z0I=K 5\>g 5G7;΂ڄ2: Bp;# Ԅ<#end<# = =c# >m# ? ty (ay .> $ /c# w 0c# ) 1#Ly 2 > X ] ] E]imDPtDQ :,(9Skey9f' R,y2QkeyQ͒K -q, key, 8<I[_ky t8= O PI֓  BT AI) TG af key”! I p key) IR Ipe p<key˕9 {key'" 6:} Y#^ Pl$- hl%ci& zΖ>'cxtxO'cy,(key{T)r{} PcxtO"*cU+r,o P@)ck)r- `$ < .'key&$S <9G .kX'keyk///~E@/F@/B0 0~00c0000w0~0 0-"  / 1a@0 1&F(1#BO`80 \21I4  CD@g-^k#y#y#5y# %y#<y#{y#y#@ y# y#$ y#( y#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hw#XA Iw#\H Jw#`O Kw#dV L#hqN#lP#pW int   M 86 ZR D Z    Ap# n # #%  ' Mlty(wy .< $/y# w0y# )1#Ly2h 8 9# :# T;# <# _k=#<- >GN n ZmP { (] (8] 8]3pos ]I ] ] P] P]ƙ6gٙt t=&old=4new=RpiReV t&4˚i $] $4] ! [4Z\2  P#!ij { t&qě$r)s" uKu#Y ؠ<y[tsyy$ ٠U%; [` Zœret\Uts]y L`[KxMT&y FiU& qmaxij& ?X>Ahs@U'; y1!t!ts1!rety A?&x X_ "  (Xx5)xx*+*%,`iϞ- "Z.]! @]1 !tsy!t/x0$m @8 $ D< $ G@ 112yV,2Sd82ڂKl81F>2 Lh82 Pp8C @(!g-^kU###5# %#<#{##@ # #$ #( #,"#0$"#4Y&U#8 *U#<,#@0r#D& 1#F 2(#GD68#H?#P: H#XA I#\H J#`O K#dV L#hqNU#lP>#pW RTX)& &  OU PU# Y# int%Z0'e\)  M 8 R )  Ap# n "# U#%)8 &)N &'UwFeUzUty(y . $/# w0# )1z#Ly29UyU?8@t].6 27NQi9URUt\)yTindUriU nUxUyԄU endU!lenUj "xT\ y7ޱUUNt#j TYiUԄU#iU[#Ul$Hp%%%x&'(O T]y"@orsm:ԄnUXVnUnU phqyllrUU.rU3) EX}CUeCUѣDyiFU#lenFUVj GAHU_HU}#(ITU"X strƤNnUmU! NsiU?iU]jUkUspsgP*vUե+K$) ind*UW,T!s,!i-Uޱ-U+  ,y*,BN,Uʦ-iU-c)..&U*.Ut.6gU. U.t <. {/p@ -vU0psgL$%%y&&*"&4@&>i  8/BN!iUUeU Uj 17 !new!iU!jUsAU(D sC!pE!rE!retF!lenGU"* U ԄUժKNlT i Ul!n U U Uv U UC5 Up ׭  M#j  LT t c )  jaUpsgD/0 d  #! UU2 yMO % % % Xy& ' & & ' / $  `,U*  !ch5U!l5U3yL lnUP7U2siUԳxU!wsUweUs2 (z5 Hz& ' & &* wzlen!UzxZX47 z_%I z'S &] 'g &s .) &)YU(!Lx TjUiUrUlU>UccUAUTPUUȺUhaUj VmbpsgD /tvUY{f.U/0!slU38{Tk:UĽc:U׽P{!slIU3h{i!slU*  jU,jU{!slsU) &5 ;)L 5=P 5>T 5?UX 5 @U\ 5yq` 5td 6"6"6 U6yU6U7AL)07<P)17a87F>V)D 7'Z46&y7w^UH 7xet8Z6  PU C(!)sg-^k###5# %#<#{##@ # #$ #( #,"+#0$1#4Y&#8 *#<,#@0#D& 1(#F 27#GD6G#H?#P: H#XA I#\H J#`O K#dV L#hqN#lPM#pW int   M 869=O 1! O R D  RHD  + Ap+# n 1# #% G ]'w z {# |#h%s J &Z# : '# +{# -# .# {/e# t0p# 1Z# A 2#( M6#0 V8#8 a=#@ F]#H G]#P H]#X X#`ty (y . $ /# w 0# ) 1s#Ly 2~  r(!!?Njq^3sT"tVu!H$,jž i X rϿrv{m Bjb H$\$]Yjv\$p$]j4p$& 273J5hj5Zbp5bp15 668rv657~b8&&$$@ &)jB8/U!to~""C3#pr X"""$" B"v"5~"b4$T (%&&&L))]j'1'1' 'F> (8fh  -CY)|+3g-^k#n#n#5n# %n#<n#{n#n#@ n# n#$ n#( n#,"#0$#4Y&#8 *#<,O#@0#D& 1(#F 2#GD6#H?a#P: Hl#XA Il#\H Jl#`O Kl#dV L#hqN#lP#pW int   M 86 ZR D    Ap# n # #{% t 'ty(ly .& $/n# w0n# )1#Ly27&B)+0@\Az|AiCUC$DnEBFm G1{f++](+$+]b -$+|+ KdiriposretToldW&y0nl  PC|+|0g-^ka###5# %#<#{##@ # #$ #( #,"(#0$.#4Y&a#8 *a#<,#@0~#D& 1#F 24#GD6D#H?#P: H#XA I#\H J#`O K#dV L#hqNa#lPJ#pW XFR"TX" 52 2  Oa Pa# Y#int%Z<'eh5  M 8 R 5 ( Ap(# n .# a#% 5D 2 5Z 2'\__sZ__nZ?Zs4a|++071aQend1a2T3ai5a\D+T,=bufBhindCatmpEwcFpsGsdlHa8a7aapss a a 8a TatmpwcoaT,8-m 7na+_knaI!{q"""#|$L%%%&g&&` a8--C .8 aLps jtmp 'TaposaV!ZH|"(y(mOaM7NaNaNatmpPpsQs 8RawcS_a-T/EO]p7^a^a_k^a!Ch|a"t"i"^"S#|&5$T%&)qaT//*src*psΒ +tmp',Z|"(yE(mn)&a/|0[--Va*ps1--[a*ps27+iao.w1aT+w2a/./.0>ap  C|05ؤ intJ/  M  %%R/6n3 4# 5 5# a 6y# 7# 8# e9# @:#+ , F|0 1 C DD KE6retG;QH6H6  D reti6Y 12Y jXDŁZ%[ZˆZ[6_\|11t}6Dleni6j6B66.Di6j6B6U!"25@D j Ö^ y6~ i68} Ԅ6!end6 !Ж' %[ЖElen6"P}p}#"y$}}##%DP&,':X@D%Dq&,'^aP(u!et (kx ("p<(j"u@H#"C5\8L10g-^k ###5# %#<#{##@ # #$ #( #,"#0$#4Y& #8 * #<,Z#@0#D& 13#F 2#GD6#H?l#P: H#XA I#\H J#`O K#dV L#hqN #lP#pW int    M 8A eR O e0e    Ap# n #  #0  'JF. Gw# /H#7eDP mHP# .`5N90v   %N} - {S .# V /#kz 0I = Sd 55]*uc oe n 8/ T i [ ; n p 57xo ;o Y67v v v bwPx`~ *}|Z!Q!F";#~$\%e%p<%{e#H~__iPx`&R7\8Q K `'''~ E( (  (~  ( ( -%( )F \3$C\8AW0 intU:  M R:y begz# {A# ptr|# N}A# ~A# \88] bp capQwA88Z capAptr_:8P:}str78A9&;ADO<AAAP::](Qc1Ac2ACm::*u:;Uqt0ttemvo܋;< ptrڋp݋r݋-cAKAretc1A<<J capptr7Ŕ<<J ptri0|tem%iA strf fdgA!Xhendj; fdA!X!end"Abuftem Aq!$!tem#A<Abp/fdAObufbp1mbp2![AcA:" A$retY@%8=D=|"%"%&`~+'''(~)*~{'''(~) ))").+;??'X'L()d,XA$!]OgAAAyp capptr-('. /:07 .TˢȎ/A071<)2L!o|82#Ax83PC$:| 'C8AGE int  M R6,/6C?AA G F% temH ŔS ptrQ R% temT $A\Gd,Alen6upQg5c6popVU6tem6[l[6[g6pӐElTE;B@new`FU\GG1cm\z6b6up1qGGLmAn leno6,p60)p6)p6up6argrLh6\,/l,1K~\ BC{8UP|8m (C G|X}W0 XF0RbT0Xburr  O P# YC# int%Z|'e u  M 89 001 00R  ]R]H uw z {o# |]# <# ,d#  # yS!# "#u(rDIR 3h %& J &# : '# +1# -G# .R# { /# t 0&#  1# A 2#( M 6d#0 V 8z#8 a =#@  F#H  G#P  H#X X<#`RR 9zGhI]wCpacR 3wpc7 7ihI Kuwn%6_ur  !"#2$#[ 7%"pslen%n%uiju%"ݐiߡjߡ& KDL'"({8KK!" )\#$#$##*KDL!+KDL$#0,XDLlNd-dirV'WV'_kW/.iY0c.lY0v/Z0j [1new[2sb\9~(&LLdr!E!93@0%*&MM!E!9 ,2lNN-dir14539*&xNN5!E!9M/R 5patGretuu%%"5patG6SNT -patP1-dirQO'_kR7XU08BpV #8W#.dZ .dp[ */\ ^/] /^)/\^]/_0/y0`0C`/La.ib0>/u3cg/d/e /+e 9/`e :K&!@"#Ve#a#lA#w$3 0459~*SS!":;!!  ( 6jT|X '" '_kV/j u/y0 /@/jt/0/`<TV3 /1i0+`UV/m\+UV/W.l03( /m3+VV1iW0= = >[Y8>iRd>V =N+C |XXp XF%int  M R;2B|XX]6_/,>U0J_k1B], %BXX]w"p#_k$BHj,CXdg-^km###5# %#<#{##@ # #$ #( #,"?#0$E#4Y&m#8 *m#<,#@0#D& 1#F 2K#GD6[#H?#P: H#XA I#\H J#`O K#dV L#hqNm#lPa#pW XFcR.TX. A> >  Om Pm# Y#int%ZH'etA  M 8 R A:5 ? Ap?# n E# m#% A[ > Aq >' 1#9#Q k /#  B# #!1"mN   # m #M wnda*vp ,     k   # m #j n Vm5U xX@Zx xend xQ m: mTZ mUC mR mWsxcNxw  @Z[0 end Q : mTZ mUC mR scRldslenm cspdnJ[\!p!vppc m;val Y"0D\\#K#A$@%W&Am\]H'c1'c2(s1p(s2h)@!p-n_km*"*5" c" not#m*y$m pc%*&+,*x0W*SWmc&mwc$% mbs'*Z(*)*&**Z+m, c/m-.2m]iu //'se/U/w0t'pe0/_k1m0p3F(n3Z0c4S(sc5T1X: 2N3Hp& #p#d4ZJ$%|5Z506X56p%7d$558؂h444#)$5@v6LH%X5d6p\$h5} "ff1#9efC 2COm>1[ 0c1Q:hh2N+]m p\pe\s\se\ ret^m c1_ c2_{miTm !xcw!sx/!sexM!py!pey_kzm|Y}$~Km1m m2mU*m."u lm# # # # $% 5 x5 ;mTmmS /w//_kms`x>lenam*m,*m=m>cmABUoN  >  >_E x  >E} h   >_E hFEFE0C~d܄2W0 XF0RbT0Xburr  O P# YC# int%Z|'e u  M R uq%dHnsrcp wc7(_%%ZLІ&% '  7  *%H܄: &esrc'len(%)ps+W&,%,%n,%:(=Xmbs>vk?T  ! " % : ; I : ;  : ;I8 $ > $ > $ >  I &I   : ;  : ; I8 I!I/ 5I: ;  : ; (  : ;  : ;  : ;  : ; I : ; I : ;I8 ' II' I : ; I8 .? : ;' I : ;I.? : ;' @ 4: ;I !: ;I".? : ;' @#.? : ;' I@$4: ;I%.? : ;' @ &: ;I'.: ;' @(.: ;' @)4: ;I*4: ;I+ ,4: ;I-4: ;I ..: ;' I@/1UX Y011.: ;' I 2.: ;' 3.: ;' 4 5: ;I6.? : ;I@71UX Y8 U941:1UX Y;1<41=1X Y>1X Y?41 @4: ; I A4: ; I? < B4: ; I?  C!D4: ;I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I   : ;  : ; I8 I!I/ 5I: ;  : ; (  : ;  : ;  : ;  : ; I : ; I : ;I8 ' II' I'  : ; I8 .? : ;' I : ;I .: ; ' @!: ; I".: ; ' #4: ; I$.? : ; ' I@%4: ; I&4: ; I'1X Y ( )41*4: ; I+1,4: ; I - : ; . U/4: ; I? < 04: ;I? < % : ; I : ;  : ;I8 $ >  : ;  : ; II !I/ $ >  : ;  : ; I8 $ >  I&I 5I : ; ( : ; ' I : ;  : ; I : ;I8 : ;I' I' I : ; I8  : ;  : ; : ;I! : ;".? : ;' I #: ;I$: ;I%.? : ;' I@ &.: ;' I@'.: ;' I@ (: ;I)4: ;I*4: ;I+.? : ;' I@ ,: ;I-4: ;I ..? : ;' @ /: ;I 0.: ;' @ 1.: ;' I@ 24: ;I3.: ;' @4.? : ;' @5.? : ;' @ 6.? : ;' @7.? : ;' I@8: ;I 94: ;I:.: ;' I@;.: ;' @<4: ;I =1UX Y>1? U@.: ;' A.: ;' I B1UX YC41D41E : ;F!I/G : ;H UI J1X YK L M.: ;I N 1O1P1X YQ.: ;' I R.: ;' S.? : ; ' I@T4: ; IU4: ; IV4: ; I W1UX YX Y4: ; I? < Z4: ;I? < [!\4: ;I?  ]4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; I8 : ; I!I/  : ; ( ' II : ; I8 .? : ;' I : ;I.? : ; ' @ : ; I.? : ; ' I@4: ; I.? : ; ' I@ : ; I4: ; I.? : ;' I@ : ;I: ;I 4: ;I !.: ;' @"4: ;I#.? : ;' I@$: ;I%4: ;I &.? : ;' @'.: ;' I (: ;I)4: ;I*1X Y+1, -41..: ;' I@/4: ;I04: ;I14: ; I24: ; I 31X Y 4.? : ; ' @51X Y61UX Y7!I/84: ; I? < 9!:4: ; I?  %  : ;  : ;I8 : ; I$ >  : ;  : ; II !I/ $ >  : ;  : ; I8 $ >  I&I : ;  : ; (  : ;  : ; I : ;I8 : ;I : ; I8 ' II.? : ;' I : ;I: ;I.? : ;' I@: ;I 4: ;I!4: ;I": ;I#4: ;I $.? : ; ' I@%: ; I&4: ; I'.: ;' I@(.? : ;' I@ ).: ; ' I@*: ; I +4: ;I,4: ;I-4: ; I.: ;I / 0.? : ; ' @1.? : ;' @2 : ;3 U4: ; I54: ; I 64: ; I 71UX Y 8194: ; I? < :4: ; I?  %  : ;  : ;I8 : ; I $ > $ > $ >   I &I  : ; : ; I8 I!I/  : ; (  : ;  : ;  : ; I : ; I : ;I8 : ;I' I.: ;' @: ;I4: ;I .? : ;' @ .: ;' @  .: ;' @ ! "4: ;I#4: ;I $4: ;I%4: ;I&.? : ;' @' U(.: ;' ): ;I*4: ;I+.: ; ' @,: ; I-1X Y .1/1UX Y 01X Y1121UX Y3 U44154: ; I6.? : ;' I@7.? : ; ' I@8: ;I9: ;I :.? : ; ' @;4: ; I <4: ; I? < =4: ; I?  % $ > $ > $ >   I : ; (  : ;  : ; I8 : ; I  : ;  : ; I : ; I : ;I8  : ;I8 : ;I : ; I8 .? : ; ' @: ; I 4: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I U4: ;I4: ;I: ; I !4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >  I &I I !I/  : ;  : ; I8  : ; 5I' I : ; (  : ;  : ;  : ;  : ; I : ; I : ;I8 : ;II' I : ; I8 .? : ;' I !: ;I".? : ; ' I #: ; I$.? : ;' I@ %.: ;' I@ &: ;I'.: ;' I@(: ;I)4: ;I*4: ;I +4: ;I,.: ;' @-.? : ;' @.4: ;I /.: ;@0.: ;' I 14: ;I24: ;I3.: ;' 4.? : ;' I@51X Y6171UX Y8 U91UX Y:41;41<.? : ;' @= > ?.: ;' @: ;IA1UX YB1C1X YD41 E : ;F UG 1H: ;I I J : ;K4: ; I L4: ; I? < M4: ; I?  N!O4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ > &I  I I !I/  : ; I8 : ; ' II& : ; (  : ;  : ;  : ; I : ; I : ;I8 : ;I'  : ; I8  : ;.? : ;' I : ;I.: ;' I@  : ;I!: ;I ": ;I #.: ;' @ $: ;I%.: ;' I@&4: ;I '.? : ;' @ (.: ;I@ )4: ;I* U+4: ;I,4: ;I-.? : ;' @..: ;' I /4: ;I0 11X Y2134144154: ;I 6.? : ;' @7.? : ;' I@ 8.? : ;' I@91UX Y:1;.: ;' @<.? : ;' @ =.: ;' >: ;I?41 @.: ;I@A.: ;' @B.? : ;' I@ C D1X YE.: ;' I F1X YG.? : ;I@H.: ;' I J1UX YK UL1 M4: ; I N4: ; IO4: ; I? < P4: ; I?  Q4: ;I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ;  : ; I : ; I : ;I8 : ;I.? : ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I : ; I4: ; I.: ; ' I : ; I: ; I .: ;' I !: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I& '1UX Y(1) U*41+ ,41-1X Y .1/1UX Y 01UX Y1.: ; ' I@24: ; I? < %  : ;  : ;I8 : ; I $ > $ > $ >   I &I  : ; : ; I8 I!I/  : ; (  : ;  : ; I8 ' II.? : ;' I@ : ;I.? : ; ' @: ; I4: ; I4: ; I.? : ;' @: ;I.? : ; ' I@ 4: ; I!4: ;I"4: ;I #: ; I $.: ; ' @%4: ; I &: ;I '4: ;I (4: ; I? < )!*4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ;  : ; (  : ; ' II : ; I8 .: ;' I@ : ;I.: ;' @.: ;' @4: ;I4: ;I.: ; ' 4: ; I.: ;' 4: ;I.: ;' I@ : ;I!4: ;I"1UX Y# U$41%1UX Y&41'.: ;' I (: ;I).: ;I * U+1,1X Y-4: ;I . /.? : ;' I@04: ; I 14: ; I 24: ; I? < % $ > $ > $ >  I : ;  : ; I8 .? : ; ' I@  : ; I 4: ; I .? : ;' @ .? : ;' @  4: ;I.? : ;' I@4: ;I4: ;I4: ;I .? : ; ' I@4: ; I4: ; I? < I!I/ 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  : ; I8 I !I/ 5I: ; ' I : ; (  : ;  : ;  : ;  : ; I : ; I : ;I8 ' I : ; I8 .: ; ' I@ : ; I4: ; I.: ; ' I@ : ; I!.: ;' @"4: ;I#.? : ;' I@ $: ;I%: ;I &.? : ;' @ ': ;I(4: ;I).? : ;' I@ *.? : ;' @ +.? : ;' I@,4: ;I-4: ;I..: ;' @/.? : ;' @0.? : ;I@14: ;I 2.: ;' I 3: ;I44: ;I 51UX Y617 U8419 : : ;; : ;I< : ;I= >.? : ;' @?.: ;' @: ;IA1UX YB1C.: ; ' I D4: ; IE.: ; ' F : ;G41H1X Y I4: ; I J4: ; I? < K4: ; I?  %  : ;  : ;I8 : ; I$ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ;  : ; (  : ; ' II : ;  : ; I8 .? : ;' I : ;I: ;I.? : ;' I@ 4: ;I 4: ;I .: ;' I@ !: ;I": ;I#4: ;I $.? : ;' I@ %.: ;' I@&4: ;I'.? : ;' I@(4: ;I)4: ;I*.? : ;' @+.: ;' I ,1UX Y-1. U/410 1.1@21341 4: ;I 5 6 U7.: ;' @8419 : ;: ;!I<1UX Y= >1X Y? @1X YA.: ;I B.: ; C4: ; I D4: ; I? < E!F4: ; I?  % $ > $ > $ >  I&I: ; I  : ;  : ; I8 : ; I8  : ;  .: ; ' @: ; I.? : ; ' I@4: ; I4: ; I.? : ; ' @ .? : ; ' @.? : ; ' @4: ; I?  4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ ' I' I : ; I8 .? : ; ' I@ : ; I: ; I4: ; I.? : ; ' I@4: ; I.? : ;' @: ;I4: ;I 4: ;I 4: ;I4: ;I4: ; I 4: ; I!4: ; I".: ; ' I #: ; I$: ; I%4: ; I &1UX Y '1( U)41*41+41 ,4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8  : ; .? : ; ' @4: ; I .: ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I4: ;I.? : ; ' I .? : ;' @4: ;I 4: ;I4: ;I 1UX Y!1" U#41$41 %41& U'1X Y(1X Y)1UX Y*: ; I+4: ; I, -.: ; ' I@.: ; I/4: ; I01UX Y 1.? : ;' I@24: ;I3.: ;' I 4: ;I54: ;I6.? : ; ' @7.? : ; ' I@84: ; I94: ; I? < :4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  : ; I8 I !I/ 5I: ;  : ; ( ' I : ; ' I.? : ;' I@ : ;I.? : ;' @ : ;I .: ;' @.? : ;' I@ .: ;' @ : ;I4: ;I.? : ;' @ .? : ;' @!.: ;' I@"4: ;I#4: ;I$4: ;I %.? : ;' I@&.? : ; ' I@ ': ; I(4: ; I)4: ;I * U+.? : ; ' I@,: ; I-4: ; I..? : ; ' @/4: ; I 04: ; I? < 14: ; I?  2!% : ; I : ;  : ;I8 $ > $ > $ >   I : ; I8 5I : ; I!I/  : ; ( ' II' I : ;  : ;  : ; I : ; .? : ;' I : ;I.? : ; ' I@ : ; I: ; I.? : ;' I@ : ;I: ;I 4: ;I!.: ;I ": ;I#1UX Y$1 %1&4: ;I'.? : ;' I@( U)41*4: ;I+.? : ;' @,4: ;I -.: ; @.4: ; I /4: ; I 0.: ; I 1: ; I2: ; I34: ; I44: ;I51UX Y6: ;I71X Y819.? : ; ' I@:4: ; I;4: ; I? < <4: ; I?  % $ > $ > $ >  I: ; II   : ;  : ; I8 I !I/  : ;  : ;  : ; I : ; I : ; I8 .: ; ' : ; I.: ; ' @: ; I4: ; I .? : ; ' @ : ; I.? : ; @ .? : ; ' @ 4: ; I.? : ;' @: ;I: ;I 4: ; I!.: ;' @"4: ;I #4: ;I$4: ;I%.1@ &1'.: ; ' @ (4: ; I)4: ;I *1X Y+1,4: ; I -4: ; I? < %  : ;  : ;I8 : ; I$ >  : ;  : ; II !I/ $ >  : ;  : ; I8 $ >  I&I : ; ' II : ;  : ; I8 .? : ;' I@ .? : ; ' I@: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I4: ;I 4: ;I!: ;I"4: ;I #.: ;' $: ;I%4: ;I&1UX Y'1( U)41 *41+41,.: ;' I@-4: ; I ..? : ;' I /: ;I04: ; I14: ; I 21UX Y 34: ; I44: ; I? < 54: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  : ; I8 I !I/ 5I: ; ' I : ;  : ; I : ;  : ; I'  : ; .? : ;' @ : ;I .? : ;' I@: ;I: ;I4: ;I 4: ;I .? : ;' @ .? : ;' @!.? : ;' @"4: ;I#.? : ; ' @$4: ; I%4: ; I &4: ; I '.: ;' (: ; I)1UX Y *4: ; I? < +4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ;  : ; (  : ;  : ; I8 .? : ;' I : ;I.? : ;' I@ : ;I.: ; ' @ : ; I: ; I.: ; ' @ .: ;' I@4: ;I 4: ;I.? : ;' I@ 4: ;I !1X Y"1#.: ;' I@$: ;I%4: ;I&.: ; ' I@'4: ; I(.: ; ' I@)4: ; I *4: ; I+.: ; ' I@,.: ;' I -4: ;I.1UX Y/ U04114: ; I 24: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( .? : ; ' I@4: ; I .? : ; ' @: ; I4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( ' II& : ;: ;I : ; I8 .: ;' I@ : ;I4: ;I4: ;I .: ; ' @: ; I4: ; I.: ; ' I : ; I4: ; I .: ; ' !.? : ;' I@"4: ;I#1UX Y$1%1X Y& U'41(41).: ; ' I@ *: ; I+4: ; I,.? : ; ' @-.? : ; ' I@.4: ; I/.: ;' I 0: ;I14: ;I24: ;I3 U41UX Y5: ;I64: ;I 7.? : ; ' @84: ; I? < 94: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8 ' II.? : ; ' @: ; I: ; I4: ; I .? : ;' I@: ;I4: ;I: ;I4: ;I .? : ; ' I@4: ; I.? : ;' I@ 4: ; I 4: ; I!.: ;' I@"4: ;I #.? : ;' @$4: ;I%4: ;I&4: ;I'4: ; I? < %  : ;  : ;I8 : ; I$ >  : ;  : ; II !I/ $ >  : ;  : ; I8 $ >  I&I : ;  : ; (  : ;  : ; I8 ' II.? : ;' I : ;I: ;I.? : ;' I@: ;I4: ;I4: ;I 4: ;I .? : ;' @!: ;I"4: ;I #4: ;I$1UX Y%1&.: ;' I@'.? : ;' I@ (.? : ; ' I@): ; I*: ; I+4: ; I,4: ; I -.: ; ' I@.4: ; I/.: ;' 04: ;I1 U24134144: ; I 54: ; I64: ; I? < 74: ; I?  % : ; I$ >  : ;  : ; II!I/ $ >  : ;  : ; I8 $ >   I &I5I : ; ( .? : ;' I : ;I: ;I.: ;' I@: ;I4: ;I 4: ;I4: ;I 4: ;I  U4: ;I1UX Y1 U 4: ;I!.: ;' I ".: ; ' I #: ; I$4: ; I%4: ; I& ' ( ).? : ; ' I@*: ; I+4: ; I,4: ; I-4: ; I . : ; /1UX Y 0111UX Y 241341441 54: ; I? < 64: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ ' II.? : ; I@: ; I4: ; I 4: ; I.: ; I : ; I.: ; I@4: ; I4: ; I U1UX Y 1414: ; I? < 4: ;I? < % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; I8 : ; I!I/  : ; ( ' II' I : ;  : ;  : ; I : ;  : ;  : ; I8 .? : ; ' @ : ; I.? : ; ' @ .: ;' I : ;I4: ;I .: ;' I@ !: ;I"1X Y#1$ %41 &.: ;' I@'4: ;I (.? : ;' I@)4: ;I*.? : ;' @ +: ;I,.? : ;' I@-.: ;' @..? : ;' @/4: ;I04: ;I14: ;I 2: ;I3 4.: ;' 51UX Y6 U74184191UX Y:1;.: ;' @ <.? : ;' I =1X Y>.? : ; ' @?.: ; ' I@@: ; IA4: ; I B4: ; I? < C4: ; I?  D4: ;I? < % : ; I : ;  : ;I8 $ > $ > $ > &I  I  : ; I8 I !I/ : ; ' II& : ; (  : ; ' I : ;  : ; I8  : ; !I/.? : ;' I : ;I.: ;' I@ : ;I: ;I 4: ;I .: ;' I@!4: ;I"4: ;I#4: ;I$.? : ;' I@ %4: ;I&.? : ;' @'.: ;' @(.? : ;' I@)4: ;I *1UX Y+1,: ;I-.: ;' .1X Y/.: ;' 0 : ;1 : ;2 U3 U4415416 7 8.: ;' I 91UX Y:1;.? : ;' I@<.: ;' I@=.? : ;' @>1X Y?: ;I@.: ;I@A.? : ; ' @B: ; IC4: ; I D4: ; I E4: ; I? < F4: ; I?  G4: ;I? < H!I4: ;I?  % $ > $ > $ >  : ;  : ; I8  I: ; I .? : ; I@  : ; I 4: ; I : ; I 4: ; I 4: ; I4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; .? : ;' @: ;I : ;I : ;I.? : ;' @ : ;I.? : ; ' I@: ; I4: ; I: ; I4: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  ( : ; : ; I8 I!I/ .? : ;' I@: ;I4: ;I4: ;I4: ;I: ;I4: ;I4: ;I 4: ;I .: ;' @.: ;' I@.? : ; ' I@: ; I: ; I4: ; I.? : ;' @ .? : ; ' @!.? : ; ' @"4: ; I #4: ; I? < $!%  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ 5I' II : ; I8 .? : ;' I : ;I.: ;' I@: ;I4: ;I.? : ; ' I@: ; I4: ; I 4: ; I1X Y 1: ;I 4: ;I .? : ;' I@!4: ;I "1UX Y#4: ; I$1UX Y%.: ; ' I &: ; I'4: ; I(.: ; ' I@)1UX Y * +41,41-.? : ; ' I@ .4: ;I/4: ; I? < 04: ; I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; (  : ;  : ;  : ; I : ; .? : ;' I : ;I.: ;' @ : ;I .: ;' I : ;I.? : ;' I@: ;I4: ;I4: ;I 1UX Y 1 !1".? : ; ' I@#: ; I$4: ; I %4: ; I&.: ;' @': ;I(4: ;I ).: ;' I@*4: ;I+4: ;I,4: ;I- .1UX Y/ U04111241 31X Y41X Y5 6417.: ; ' I 8: ; I9.? : ; ' @:4: ; I;1UX Y <4: ; I =4: ; I? < >4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; (  : ; ' II : ;  : ; I8  : ;: ;II.? : ; ' @ : ; I .? : ; @: ; I.: ;' I@ : ;I : ;I !.: ;' I@"4: ;I#4: ;I $.: ;' @%: ;I&4: ;I '.? : ;' I@(4: ;I)4: ;I*.: ;' I +: ;I,4: ;I-1UX Y.1/ U0411.: ; ' I 2: ; I34: ; I4: ; I5.? : ;I@61X Y7 84194: ; I :: ;I;1UX Y<1=41 >4: ; I? < ?4: ; I?  @4: ;I? < A!%  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; (  : ; I8 ' II.? : ; ' I@ .? : ; ' @ : ; I.? : ; ' I@: ; I4: ; I4: ; I4: ; I4: ; I .? : ; ' @.: ; ' @ 4: ; I .? : ; ' @!.? : ; ' @ "4: ; I? < #4: ; I?  % $ > $ > $ > I!I/ 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( .? : ; @ : ; I.: ; I@.? : ; I@4: ; I4: ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ .? : ; @4: ; I4: ; I? < 4: ; I?  % $ > $ > $ >  I&I : ;  : ; I8 : ; I ' I I 4: ; I?  I!I/ 4: ;I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  ( : ; : ; I8 I!I/  : ; I8 .? : ; I@: ; I4: ; I4: ; I4: ; I .: ; ' @4: ; I4: ; I4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >   I : ; : ; I8 I !I/ ' II : ; ( .: ;' I : ;I4: ;I4: ;I.? : ; I@: ; I4: ; I4: ; I : ;1UX Y 1 U411UX Y 41!4: ; I? < "4: ;I? < % $ > $ > $ >  I : ; (  : ;  : ; I8 : ; I .: ; ' I@ .? : ; I@ : ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > $ >  I : ;  : ; I8 : ; I ' I I .? : ; I@ : ; I 4: ; I4: ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8 ' II.? : ; ' I@: ; I4: ; I4: ; I 4: ; I4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; I8 : ; I !I/  : ; ( ' II.: ; ' I@: ; I4: ; I.: ; ' @4: ; I 4: ; I.? : ;I@: ;I4: ;I4: ;I4: ;I .: ;' I@4: ;I.: ;' I  : ;I!4: ;I".? : ; I@#4: ; I$1X Y%1& '41(4: ; I? < )4: ; I?  % .? : ; I@ : ; I$ >  I$ > .? : ; I@ % : ; I$ > $ > $ >  I : ;(  : ;   : ;  : ; I8  : ;  : ; I : ; I : ;I8  : ;I8 I.: ; ' I 4: ; I.? : ; I@: ; I4: ; I4: ; I 4: ; I1UX Y  U4141 .: ; ' @ : ; I!4: ; I? < %  : ;  : ;I8 : ; I $ > $ > $ >   I &I  : ; : ; I8 I!I/ ' II& : ; ( .? : ;' I@ .? : ;' @ .? : ;' I@: ;I4: ;I 4: ;I.: ;I@  U4: ;I4: ;I 4: ;I !.? : ;' @"4: ;I#: ;I$.? : ; ' @%.? : ; ' I@&: ; I'.? : ; ' @(: ; I )*4: ; I+.? : ;' @,: ; I-4: ; I? < .!/4: ;I?  04: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ;  : ;  : ; I : ; I : ;I8 : ;I' II.: ; ' I@: ; I4: ; I4: ; I 4: ; I U4: ;I U 4: ;I! "4: ; I#.? : ; ' I@$.? : ; ' I@ %4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ .? : ; ' I : ; I.? : ; I@: ; I4: ; I 4: ; I4: ; I : ; 1X Y 111X Y 4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( ' II : ;: ;I.: ; ' : ; I4: ; I.: ; ' I .? : ; I@: ; I4: ; I4: ; I1UX Y 1 U 41!1UX Y "4: ; I? < % $ > $ > $ >  I : ;  : ; I8 : ; I .? : ; I@ : ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I   : ;  : ; I8 I!I/ 5I: ;  : ; (  : ; ' I : ;  : ; I8 ' I.? : ;' I : ;I.: ; I@: ; I4: ; I4: ; I 4: ; I!4: ; I"4: ; I # : ; $1X Y %1&.? : ;' I@': ;I(4: ;I)4: ;I *.? : ;' I@ +4: ;I,4: ; I? < -4: ; I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; 5I : ;  : ; (  : ;  : ; I : ; I : ;I8 ' II' I.: ;' I : ;I4: ;I4: ;I.? : ; ' I@ : ; I!4: ; I"4: ; I#4: ; I$ : ;% U&4: ;I'1UX Y(1)41*41+.? : ; ' @,4: ; I? < -4: ;I? < .4: ; I?  % $ > $ > $ >  I : ; (  : ;   : ;  : ; I8 : ; I  : ;  : ; I.: ; I@: ; I4: ; I.? : ; I@4: ; I4: ; I 4: ; I : ; 4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( .? : ; ' @ .: ; ' I@: ; I4: ; I.? : ; ' I@4: ; I 4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >  I &I  5I : ; : ; I8 I!I/  : ; ( I : ; I8 .? : ;' I : ;I.: ;' I@: ;I4: ;I4: ;I4: ;I1X Y1.: ;' I 4: ;I .: ;' !.? : ; I@": ; I#4: ; I$4: ; I %4: ; I&1UX Y ' U(41)1X Y *1+1X Y, -41. U/1UX Y04: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8  : ; .: ; ' I@: ; I.: ; ' I : ; I: ; I4: ; I4: ; I.? : ; I@4: ; I4: ; I1UX Y 1 U41 41!1UX Y "4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ 5I : ; ( ' II.: ; ' 4: ; I4: ; I: ; I.? : ; I@: ; I4: ; I4: ; I4: ; I 1UX Y 1 U 41!41"1X Y #41 $4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  5I : ; : ; I8 I!I/  : ; ( .? : ; ' I : ; I.: ;' I@: ;I4: ;I.? : ;' I@4: ;I4: ;I.: ;' : ;I4: ;I.: ;' I  .: ; ' I  : ; I!4: ; I"4: ; I #.? : ; I@$: ; I%4: ; I&4: ; I'1X Y (1) U*41+1UX Y ,41-1X Y.1UX Y /1UX Y0114: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( .: ; ' : ; I4: ; I.? : ; I@: ; I4: ; I 4: ; I4: ; I  : ; 1UX Y 1 414: ; I? < % $ > $ > $ >  I : ; (  : ;  : ; I8 : ; I .? : ; I@ : ; I 4: ; I4: ; I%  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( .? : ; ' I : ; I.: ;' I@: ;I: ;I.? : ;' I@4: ;I.? : ;' @4: ;I 4: ;I.: ;' @ .: ;' 4: ;I4: ;I  U1X Y !41"1#1X Y$: ;I%.? : ; ' I@&: ; I'4: ; I(4: ; I)4: ; I*1UX Y+4: ; I ,4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I   : ;  : ; I8 I!I/ : ; ' I : ; (  : ; I : ;  : ; I8 ' I.: ;' @ : ;I .: ; ' @.: ;' @: ;I4: ;I .: ;' I@!: ;I".? : ;' I #: ;I$.: ;' %: ;I&4: ;I'.: ;' I (4: ;I).? : ; I@*: ; I+4: ; I,4: ; I-4: ; I .4: ; I / : ;01UX Y112 U34144151X Y6.: ; ' @7: ; I84: ; I? < 9!:4: ;I? < % $ > $ > $ >  I : ; ( : ; I I !I/  : ;  : ; I8  : ;  : ; .? : ; I@: ; I4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( ' II : ; .: ;' I@ : ;I.? : ;' @ .: ;' I@4: ;I.? : ;I@4: ;I4: ;I 4: ;I U.? : ;' @4: ;I .? : ; ' I@ : ; I!4: ; I "4: ; I#.? : ;' I@$.: ;' @ %4: ;I&.: ;' ' U(1UX Y)41*&I+4: ; I? < ,!-4: ;I? < .4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ;  : ;  : ; I : ; I : ;I8 ' II.? : ;' @: ;I4: ;I4: ;I.? : ;' I@: ;I4: ;I .? : ; ' I@: ; I 4: ; I!4: ; I"4: ; I # $4: ; I%.? : ; I@ &4: ; I? < % $ > $ > $ >  I : ; (  : ;  : ; I8 : ; I .? : ; I@ : ; I 4: ; I4: ; II!4: ; I? < 4: ; I?  % $ > $ > $ >  I : ; (  : ;  : ; I8 : ; I I  .? : ; I@: ; I4: ; I.: ; ' @4: ; I? < I!4: ; I?  % $ > $ > $ >  I : ;  : ; I8 : ; I .? : ; I@ : ; I 4: ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( .? : ; ' I : ; I.? : ; I@: ; I4: ; I 1X Y 11UX Y 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I '  I : ; : ; I8 I!I/ .: ; ' @: ; I4: ; I 4: ; I.: ; ' I : ; I4: ; I4: ; I.? : ; I@: ; I4: ; I U1UX Y 1 U41 41!4: ; I? < "!%  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ;  : ;  : ; I : ; I : ;I8 ' II.? : ; ' I@: ; I4: ; I 4: ; I4: ; I4: ; I4: ; I  4: ;I .? : ; I@! U"4: ; I# U$&I%4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ;  : ; I8  : ; .: ;' I@ : ;I4: ;I .: ;' I : ;I4: ;I.: ;' I@: ;I4: ;I4: ;I 1X Y1  41!1X Y" U#41 $.: ;' @%.: ;' &4: ;I': ;I( ) *&I+.? : ;I@,4: ;I-1UX Y.1UX Y/104114: ; I 24: ; I? < %  : ;  : ;I8 : ; I$ > I!I/ $ > $ >    I : ; : ; I8  : ; ( .? : ; I@: ; I4: ; I 4: ; I4: ; I4: ; I.: ; ' @: ; I4: ; I .: ;' I : ;I4: ;I4: ;I1X Y 1 U 41!41"4: ; I? < % $ > $ > $ > : ; I I : ;  : ; I8 I !I/ 5I  : ;   : ; .? : ; I@: ; I4: ; I4: ; I U4: ; I4: ; I4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II.? : ; ' @ : ; I .: ; ' I@: ; I4: ; I.: ; ' I : ; I4: ; I4: ; I .? : ;I@: ;I4: ;I1UX Y11 U!41"41 #4: ; I? < $!%  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ( ' II : ; .? : ; ' @ .? : ;' I@ : ;I.: ;' I@4: ;I 4: ;I .: ;' @: ;I4: ;I.: ;' @ 4: ;I.? : ;' I@4: ;I .: ;' I !: ;I"4: ;I#.? : ; I@$: ; I%4: ; I&4: ; I'1X Y (1)1* +41,1UX Y - U.41/1UX Y 04: ; I 1&I24: ; I 34: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( .? : ;' I : ;I.? : ; ' I : ; I.: ;' I@ 4: ;I.: ;' I@: ;I: ;I4: ;I4: ;I4: ;I.: ;' @1UX Y1 4: ;I ! U"1X Y# U$.: ;' I %: ;I& '.? : ; I@(: ; I)4: ; I*4: ; I+4: ; I,1UX Y-41.41/ 04: ; I 14: ; I 24: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( .? : ; ' @: ; I.? : ; ' I@4: ; I4: ; I4: ; I 4: ; I?  4: ; I? < % $ > $ > $ >  I : ;  : ; I8 : ; I .? : ; @ .? : ; I@ : ; I 4: ; I 4: ; I I!I/ 4: ; I 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8  : ;: ;I.: ; ' I : ; I4: ; I 4: ; I.: ; ' I@: ; I: ; I: ; I 4: ; I4: ; I4: ; I 1UX Y  1! U"41#1UX Y $1 %.? : ;I@&: ;I'4: ;I(4: ;I).: ;' @ *.: ;' I@+: ;I,.: ;' I@ -4: ;I..: ;' I /: ;I01X Y1124131UX Y4&I54: ; I? < % $ > $ > $ >  I&I : ; I  : ;  : ; I8 : ; I8 ' I I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I U.? : ; I@ 4: ; I 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  ( : ; : ; I8 I!I/ .? : ;' I@4: ;I .? : ; ' I@4: ; I 4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >   I : ; : ; I8 I !I/ .? : ; I@ : ; I4: ; I4: ; I? < % : ; I$ > $ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I I !I/ I% : ; I$ > $ > $ >  I.? : ; @ .? : ; @ : ; I 4: ; I .? : ; I@ 4: ; I 4: ; I 4: ; II!I/ % $ > $ > $ > : ; I : ;  : ; I8 I !I/ .? : ; ' I@  : ; I  I .? : ;' I@: ;I4: ;I .? : ; ' I@4: ; I .? : ; ' @4: ; I %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; : ;I 8 : ;I : ; : ; (  : ; I8 ' II.? : ; ' I@: ; I4: ; I 4: ; I4: ; I4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; I8 .? : ;' I : ;I.? : ; I@: ; I1X Y 1 4: ; I 1UX Y .: ; ' I : ; I 4: ; I 4: ; I.? : ; ' I@ 1UX Y !1" #41$ U%41 &4: ; I? < % $ > $ > $ > : ; I : ;  : ; I8 I !I/ .? : ; I@ : ; I 4: ; I 4: ; I %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; : ; .: ;' I : ;I: ;I.: ; ' I : ; I: ; I4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I1UX Y1 U!41"41 #4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >   I : ; I8 : ; I !I/ .? : ; I@: ; I: ; I 4: ; I 4: ; I4: ; I.? : ; @4: ; I4: ; I 4: ; I? < % $ > $ > $ >  I&I.? : ; ' I@: ; I : ; I 4: ; I 4: ; I 4: ; I%  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; I8 : ; I!I/ .? : ;' I : ;I.: ; I@: ; I4: ; I4: ; I 1X Y 1.? : ; ' I@4: ; I4: ; I  U U4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ .: ; I : ; I: ; I.? : ; ' I@: ; I4: ; I 4: ; I4: ; I4: ; I : ; 1UX Y 1!I/.? : ;' I@: ;I4: ;I4: ;I 4: ; I? < % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; I8  : ;  ( : ; I!I/ .: ; ' I .: ; ' I@: ; I4: ; I1UX Y .? : ; ' I@4: ; I 4: ; I.? : ; I@4: ; I .? : ;' I : ;I4: ; I1UX Y 1 4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II : ;: ;I.? : ; ' @: ; I: ; I4: ; I .? : ;I@ : ;I: ;I4: ;I.? : ;I@4: ;I4: ;I.? : ; ' @ .? : ; ' I@4: ; I 4: ; I!4: ; I"4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I ' I I & : ;  : ; I8 I!I/ .? : ; ' I@ : ; I4: ; I.? : ; ' @4: ; I.? : ; ' I@4: ; I: ; I4: ; I 4: ; I  U4: ; I4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I  : ;  : ; I8 I !I/ : ; I< : ; .: ; ' I : ; I: ; I4: ; I4: ; I  .? : ; I@: ; I4: ; I 4: ; I4: ; I 1UX Y 1 U 41 !41"41#1 $1%!I/&4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ .? : ; I@ : ; I4: ; I.? : ; I@4: ; I 4: ; I 4: ; I4: ; I: ; I4: ; I? < !%  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( .? : ; ' I : ; I.? : ; ' I@: ; I4: ; I4: ; I : ; I4: ; I4: ; I4: ; I U1UX Y 1.? : ;' I@: ;I : ;I!4: ;I "4: ;I#4: ;I$4: ;I%4: ; I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; : ; I< .? : ;' I : ;I.? : ; I@: ; I: ; I4: ; I 4: ; I4: ; I 4: ; I4: ; I1X Y 11UX Y !I/ 4: ; I? < % : ; I$ > $ > $ >  I : ; ( .? : ; I@ : ; I : ; I 4: ; I 4: ; I% : ; I$ > $ > $ >  I : ; ( .? : ; I@ : ; I : ; I 4: ; I 4: ; I% : ; I$ >  : ;  : ; II!I/ $ >  : ;  : ; I8 $ >   I &I.? : ;' I : ;I: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I1X Y 1% $ > $ > $ > : ; I I.? : ; I@: ; I 4: ; I 4: ; I 4: ; I I !I/ %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; I8 : ; I !I/ .? : ; @: ; I: ; I4: ; I 4: ; I4: ; I? < % : ; I$ > $ > $ >  I&I : ;  : ; I8  : ;  I !I/ : ; I< .? : ;' I : ;I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I  : ;1UX Y 1 U4: ;I4: ; I4: ; I1X Y  U !!I/% : ; I$ > $ > $ >  I.? : ; I@: ; I 4: ; I 4: ; I % : ; I : ;  : ;I8 $ > $ > $ >  I &I   : ;  : ; I8 I!I/ : ;  : ; ' II' I' '  : ; ( !I/ : ;  : ; I8  : ; : ;I8 .? : ;' @ .? : ;' I@: ;I 4: ;I!.: ;' @"4: ;I #.: ;' $1UX Y%1X Y&1UX Y'.: ;' I@(4: ;I ).? : ;' @ *.? : ;' @+: ;I,4: ;I-4: ;I.4: ;I/ 0.? : ;' I@ 1.? : ;' @2.: ;' I 3.: ;I 4 U54164174: ; I 84: ; I? < 94: ; I?  :4: ;I? < ;4: ;I?  %  : ;  : ;I8 : ; I$ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ; ' II : ; ( !I/ : ;  : ; I8 .? : ; ' @ 4: ; I.? : ; ' @ : ; I: ; I .? : ;' I@ : ;I!.? : ;' I@ ": ;I #.? : ; ' @$: ; I%: ;I&.: ;' I@'4: ;I(.: ;' I@ )4: ;I *.: ; ' @+.: ;' @,4: ;I -.? : ;' I@..: ;' @/4: ;I04: ;I1 2 34: ;I4.: ;I@5 U6.? : ; ' I@74: ; I8.: ;' I 9: ;I:1UX Y;41<1UX Y=1>41? U@.: ;I A: ;IB1X YC1D41 E.? : ;' @F.? : ; ' I@ G4: ; I H4: ; I? < I4: ;I? < J4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ ' II&.? : ; ' I@: ; I.? : ; ' @4: ; I4: ; I 4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II!I/.? : ; ' @: ; I4: ; I.? : ; ' I@4: ; I 4: ; I 4: ; I4: ; I? < 4: ; I?  4: ;I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II'  : ; (  : ; I8 .: ;' @.: ; ' I@: ; I: ; I4: ; I.: ; ' @.: ;' I@: ;I: ;I4: ;I 4: ;I4: ;I .? : ;' I@!4: ; I"4: ;I#.: ;I@$.: ; ' I %: ; I&: ; I'4: ; I(1UX Y)1* U+41,41-.? : ;' I@ .4: ; I /4: ; I? < 04: ;I? < 14: ; I?  % : ; I : ;  : ;I8 $ > $ > $ >   I  : ;  : ; I8 I !I/ ' I' : ; ' I!I/.: ;' @ : ;I: ;I4: ;I.: ;' @: ;I .? : ;' @ .: ;' I@.? : ;' I@4: ;I.? : ;' I@.: ; '  : ; I!4: ; I"1UX Y#1$ U%41 &.? : ;@'4: ;I (4: ;I).: ; ' @*.? : ;' @+4: ;I ,.: ;' -: ;I.1UX Y/1 04: ; I 14: ; I? < 24: ;I? < 34: ; I?  % : ; I : ;  : ;I8 $ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I ' II&: ;  : ; : ; I< ' ' I : ; ( .? : ;' I : ;I.? : ;' I@  : ;I!.: ;' @": ;I #.: ;' I@$: ;I%4: ;I &.? : ;' @'4: ;I(4: ;I)4: ;I* +4: ;I ,4: ;I- ..: ;' I / 0 11UX Y213 U441541641 71X Y81X Y9.? : ;' I@:1;.: ;' <: ;I=4: ; I? < >4: ;I? < ?4: ; I?  @4: ;I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; : ; I8 I!I/ ' II : ; ( !I/: ;I : ; : ;I8 .? : ;' I : ;I.? : ; ' I@: ; I: ; I U4: ; I4: ; I .? : ; ' I@  : ; I !4: ; I".? : ;' I@#: ;I$: ;I%4: ;I&.? : ;' I@ '4: ;I(.? : ;' @ ): ;I *.? : ;' I@ +.? : ;' @ ,.: ;' @-.: ;I@..: ;' I@/4: ;I01X Y1124: ;I 34: ;I44: ;I 5 U6 7 8.? : ;' @9.: ;@:.: ;I ;.: ; <: ;I=1UX Y>1UX Y?41@.: ;' I A1B41C D41 E4: ; I? < F4: ;I? < G4: ;I?  H4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II'  : ; (  : ; I8 .? : ; ' @: ; I: ; I.: ;' : ;I.: ;' I@: ;I1UX Y1.: ; @4: ; I4: ; I .? : ;' I@!4: ;I"4: ;I#4: ;I$ %4: ;I&.? : ; ' I@'4: ; I(.: ; ' I ): ; I*: ;I+ U,41-41..? : ; ' I@ /4: ; I 0&I14: ; I? < 24: ;I? < 34: ; I?  % : ; I : ;  : ;I8  $ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ; '  : ; (  : ;  : ; I8 .? : ;' I : ;I: ;I.? : ;' I@ .? : ;' I@4: ;I.? : ;' I@ .? : ;' @!4: ;I".: ;' @#.? : ;' @ $.: ;' @%: ;I&4: ;I '.? : ;' @ (.? : ;' @): ;I*4: ;I+.: ;' I@,1X Y-1..: ; I@/: ; I0: ; I14: ; I24: ; I34: ;I4 5.: ; 61UX Y7 U8419: ;I :;.: ;@<.: ;' = > ?4: ;I @ UA1B4: ; I C4: ; I? < D4: ;I? < E4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; ' I : ;  : ; I : ;  : ; I' .? : ;' @4: ;I.? : ;' I@4: ;I .? : ;' @.: ; ' I@: ; I: ; I 4: ; I !4: ; I ".: ;' @#: ;I$: ;I%4: ;I&4: ;I'.: ; @(4: ; I)4: ; I? < *4: ;I? < +4: ; I?  %  : ;  : ;I8 : ; I$ > : ;I$ > $ >   I &I   : ;  : ; I8 I!I/  : ; : ;  : ; ( ' II.? : ;' I@ : ;I.? : ;' I@ 4: ;I 4: ;I U4: ;I.? : ; ' I@: ; I 4: ; I !4: ; I": ; I#4: ; I $4: ; I%4: ; I&4: ; I'.? : ; ' @(.? : ; ' I@).? : ; ' I@ *4: ; I? < +4: ;I? < ,4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ > &I   I : ; : ; I8 I!I/ ' II.? : ; ' I@ : ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I.? : ;' I@: ;I4: ;I .? : ;' I@ 4: ;I.: ; ' I@: ; I4: ; I 4: ; I! ".? : ; ' I@#4: ; I $4: ;I%4: ; I &4: ; I? < '4: ;I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/  : ; (  : ; I8 .? : ; ' I@ : ; I: ; I : ; I 4: ; I .? : ; ' I@4: ; I .? : ;' I@: ;I: ;I.? : ; ' @4: ; I4: ; I.: ; I@: ; I .? : ;' I@!.? : ; ' I@" #4: ;I $4: ; I%4: ; I? < &4: ; I?  '4: ;I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ .? : ; ' @4: ; I: ; I.? : ;' @ : ;I.? : ; ' I@.? : ; ' @4: ; I: ; I4: ; I 4: ; I? < 4: ;I? < 4: ; I?  % : ; I : ;  : ;I8 $ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ > &I  I: ; ' II' I.? : ; ' I@ .: ; ' I@ .: ; ' I@: ; I.? : ; ' I@.? : ;' I@ : ;I4: ;I.? : ;' I@.? : ;' I@ : ;I!4: ;I"4: ;I # $4: ;I%4: ;I& '4: ;I (.: ; ' I )4: ; I*4: ; I+ , -1UX Y. U/41041 1412.? : ;' @34: ; I 4!I/54: ; I64: ; I? < 74: ;I? < 84: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I   : ;  : ; I8 I!I/ : ; ' II' '  : ; (  : ; I8  : ; .? : ; ' @ : ; I.? : ; ' I@: ; I4: ; I.? : ; ' @.: ; @.? : ; ' @ 4: ; I!4: ; I"4: ; I#4: ; I $4: ; I? < %4: ;I? < &4: ; I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; : ; I8 I!I/ ' II' !I/ : ;.? : ;' I : ;I.? : ;' @ : ;I .? : ;' @: ;I: ;I.? : ;' @ .? : ;' I@.? : ;' I@4: ;I.? : ;' I@  4: ;I !.: ;' @"4: ;I #.? : ; ' @$: ; I%: ; I&4: ; I'4: ; I (4: ; I )4: ; I*1X Y+1,1X Y-.: ; .: ;I/4: ;I04: ;I14: ;I21UX Y3 U4415.? : ;' @64: ; I? < 74: ; I? < 84: ;I? < 94: ; I?  %  : ;  : ;I8 : ; I$ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ; '  : ; (  : ;  : ; I8 ' II.? : ; ' @ : ; I .? : ;' I@ : ;I: ;I : ;I : ;I!.? : ;' I@" #4: ;I$.? : ; ' I@%: ; I&: ; I' U(4: ;I)4: ;I *4: ;I+.: ;' I@,4: ;I -4: ;I. /.? : ; ' @04: ; I14: ; I24: ; I 3 U4.: ;I@5.: ;' I@ 64: ; I 74: ; I? < 84: ;I? < %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ( .: ; ' I : ; I4: ; I.? : ; ' I@4: ; I4: ; I1UX Y 1 U414: ; I? < 4: ;I? < %  : ;  : ;I8 : ; I$ > $ > $ >   I : ; : ; I8 I !I/ ' II' !I/ : ; (  : ; I8 .? : ; ' @ .: ;' @ .? : ;' @ : ;I : ;I .? : ;' I@: ;I: ;I.? : ;@.? : ;' I@4: ;I .? : ;' @!4: ;I".? : ;' @#.? : ; ' I@$.? : ; ' I@%4: ; I&.? : ; I@': ; I(4: ; I )4: ; I*4: ;I +4: ;I,.: ; ' I@-.? : ; ' @.: ; I/4: ; I? < 04: ;I? < 14: ; I?  24: ;I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ .? : ; ' @: ; I .? : ; ' @ .? : ; ' I@ .? : ; ' I@ : ; I: ; I4: ; I.? : ;@: ;I: ;I4: ;I4: ;I 4: ;I .? : ;' I@4: ;I.? : ;' I@ .? : ; ' I@!4: ; I"4: ;I#.? : ; I@$4: ; I %.? : ;I@&.? : ;' @'.: ; ' I (1UX Y) U*41+41 , -.? : ;' I .: ;I/1UX Y 0114: ; I? < 24: ; I?  %  : ;  : ;I8 : ; I$ >  : ;  : ; II !I/ $ >  : ;  : ; I8 $ >  I&I : ; ' II.: ;@ : ;I: ;I 4: ;I .: ;' I@: ;I4: ;I4: ;I U4: ;I.: ;' I : ;I : ;I!4: ;I".: ;I@#4: ;I $1X Y%1&41'41(.? : ;' I@ ).? : ;' I@* +.? : ; ' I@,: ; I-4: ; I.4: ; I/ 04: ; I 1.: ; 21UX Y3 U41UX Y54: ; I 64: ; I? < 74: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ .? : ;' I : ;I.: ; I@: ; I4: ; I 4: ; I.: ;I@: ;I4: ;I4: ;I U.? : ;' I@ .? : ;' I@4: ;I  : ;1X Y1 .? : ; ' I@!: ; I"4: ; I#4: ; I$ : ; %1X Y &.? : ; ' I@ '4: ; I? < (4: ; I?  %  : ;  : ;I8 : ; I$ > $ > $ >  I &I  : ; : ; I8 I!I/ .: ; ' I@: ; I4: ; I 4: ; I4: ; I U.? : ; ' I@ .? : ; ' I@: ; I4: ; I? < 4: ; I?  %  : ;  : ;I8 : ; I$ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ; .? : ;' I : ;I: ;I.? : ;' I@: ;I: ;I : ;I4: ;I 4: ;I4: ;I.: ; I : ; I4: ; I 4: ; I!1UX Y"1# U$41 %41&41'4: ;I(1).? : ; ' I@*: ; I+4: ; I,1UX Y -: ; I.4: ; I /4: ; I? < 04: ; I?  % $ > $ > $ >  I&I: ; I : ;  : ; I8 ' I I .: ;' I@ : ;I4: ;I4: ;I.: ;' I : ;I4: ;I.? : ;' I@4: ;I1X Y1 U41.: ; ' I : ; I: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I!4: ; I"1UX Y #41$1UX Y %I&!I/ '4: ; I (4: ; I?  % : ; I : ;  : ;I8 $ > $ > $ >  I &I  : ; : ; I8 I!I/  : ; ' II' !I/.? : ; ' I@ : ; I4: ; I.: ; ' I : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I 1UX Y !1"1# U$41%41&.? : ; ' @'4: ; I? < (4: ;I? < )4: ; I?  % : ; I$ > $ > $ >  I&I : ; : ;I8 : ;I8 .: ; I@  : ; I : ; I .? : ; I@4: ; I.? : ;@: ;I: ;I4: ;II.: ;I@ : ;I 4: ;I4: ;I.: ; @.: ; I@: ; I4: ; I4: ; I.: ;I  : ;I!: ;I"4: ;I#.? : ;I@$ : ;% &1UX Y'1( U)41*1UX Y+1X Y,.? : ;' I -1UX Y .4: ; I /I0!I/ 14: ;I 24: ;I?  34: ;I?  % $ > $ > $ > I!I/  I.: ; @ .: ; I  : ; I 4: ; I : ; I .: ; I@: ; I: ; I4: ; I4: ; I 4: ; I 4: ; I : ;  : ; U1UX Y 1411UX Y .? : ; I@: ; I 4: ; I?  % : ; I$ > : ;I : ;  : ; II!I/ $ >  : ;  : ; I8 $ >   I&I : ; 5I : ; : ; I< .? : ;' I : ;I.: ; ' I@ : ; I4: ; I4: ; I4: ; I .: ; ' I : ; I4: ; I.? : ; ' I@4: ; I 1UX Y !1" U#41$41%.: ; ' &.: ;' @': ;I(1X Y)41 *1X Y+ ,.: ;' I@-: ;I.4: ;I/4: ;I04: ;I14: ;I24: ;I 3 U44: ;I 5: ; I6.? : ;' I@7 : ;8 : ;I8 91UX Y:1;1UX Y< : ;=4: ; I? < >4: ; I?  % $ > : ;I$ > $ >  I.? : ; ' I@ : ; I .? : ; ' I@ %  : ;  : ;I8 : ; I$ > : ;I : ;  : ; I I !I/ $ >  : ;  : ; I8 $ >  I&I : ;  : ; (  : ; .? : ;' I : ;I.: ;' I@: ;I: ;I 4: ;I 4: ;I4: ;I.: ;I : ;I 4: ;I!: ;I"1X Y#1$ U%41&.: ; I@': ; I(4: ; I ).: ;' I *4: ;I+ : ;, - ..: ; ' I@/: ; I04: ; I1 U24: ; I31UX Y 41541641 7 181UX Y9 : ;.? : ; ' I@<4: ; I=.: ; I >: ; I?4: ;I @ A: ; IB4: ; IC1 D.? : ;I@E4: ; I F4: ; I? < % : ; I$ > : ;I : ;  : ; II!I/ $ >  : ;  : ; I8 $ >   I&I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I  U4: ; I4: ; I + /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsshell.cstat.hlibio.hstdio.hstddef.htypes.htypes.htime.hsigset.hstdint.hstat.hpwd.hsetjmp.hsetjmp.hcommand.hgeneral.harray.hhashlib.hvariables.hshell.hbuiltins.hinput.hbashjmp.hflags.hbashhist.hlocale.h( 2KLw ,t.X,0//~/-/LI~./gK/-//J+1/K/ f11,L-/ wJKKKKM~T.1.j2fJM2f0,01-/-/-0I/,2*20>ei,",&=Lghhg/KML,a.|,2/0y.5+/01,0,L0|+1K0,-fJ2LL ghf2bJ-/-/KgI/e030,3)3G .-/G1+OeMfjwOrf,tJ1LM0 !uJJ .,0/Jg؉PA J4/-/x.6.WJ/Iy.6.LfIL0L\f./-/hKKK1+1yf0,0gl/-/-0-//-/PKF2.r.0 .u.-K-/0vJ.yJ0*/ .m.4/6N1 .u. Ju./ JK-/1+14-/+4 .w.32*)32/hu.-/-.w..m-/-g-/K)3wfJ}..}.J؟I0Oc(.X.}f,0l/-.}J.}..KpJ )3}<*2LKMge2h-4a5h .-K-w  sh-/I/~.v.4/M f4M04w/0-/-/3KL f/-K-K6*2*2LKKJ )* .*-/2}..}..}.. $< .\* .2*2*2*20hn =g|f -/-/N,0,0,-12gKfUhL}@J4F  JyKJx..-0xJTf0f[KOpJ~wJ/0K-g/x,0,0,1+1fwJg f|{fcJgxvfJKKw 0 J-/I/z${/-~f KI1{u{2*2*2*26~Ji{h>~~1,0@i/}fOK"JI/-Kg.>|F/22kJJ3o /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitseval.cstdlib.hlibio.hstdio.hstddef.htypes.hsigset.hsetjmp.hsetjmp.hcommand.hstdint.harray.hhashlib.hvariables.hsig.hinput.hbashjmp.hquit.hshell.hflags.hlocale.h`/-//f2F2/3KKLg0,0K1YfKL, .s.3Ry.5y.Q .kg0,0KjgfL"af~t5y.5+O,hji1LL,0֣-/-/-//5h-/0,L//,/*31hK Jgf0,0,LJ-/5.K./,0/3fRX-/-/-/1I/-8JghKJ-/-//,B /Users/chet/src/bash/src/usr/arm-none-linux-gnueabi/usr/include/usr/share/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/sysparse.ywchar.hbison.simplelibio.hstdio.hstddef.htypes.htypes.htime.hstdint.hcommand.hgeneral.harray.hvariables.hsig.hshell.hinput.hparser.halias.hbuiltins.hsyntax.hquit.hflags.hbashline.hbashhist.hlocale.hȫ././-//-/Kf.h$f.1N2x.MGf.J.ejJ.0gg.e1.tl. &.$a.B.   0,`.NQG?$.!l-/-//m1-/h1+/0,Lx. JKJy.5z.Pz./0*001/10I/M-H1-0yt{./K,0-/O*0/0f3)32-K-/0/M/-/3+32t./01+1020z.20//N/-/1-+/0/-//e1+1/K-//-/L3Og0/-/01+102*2r.101020KM1+1,1+1*/0/1sJgifKIx0,0,0!bf2/Y-/-1/-e/-0,0--LK&1w. .fJ2FJ2B1+1F/-/X1G1itw.Rx.) .t.*fp.*m.|//-f3)3h/-/L/+0K\#.u.\.#.\.#oJ34z.02*2 J\.$.\.$.\.&.sJl/-/-eg-K24y.0/,4*-,5y. .+w.0//052*M//-0-5I...עi~f01fNJK/,//>.L=NNicM h=L@,3+---jM|"frJ.h,0,0 fh,0.L}.}.Jz./-4z.gK2/I/KKgK .M}Jd}t0ngM2K0+/0-@Jy K-/؟e~JL,0KLH0l0K+6-2Y JLLLLLM/0L*00#JJK-0-/-L4z.0/*5*/1,0L/N,L-/J.JK-/1 L J3)O.9h,3K1+1+M+2-0z.20nK/,0-0/I0/L/T K-/0,/-g-O/-gք~.q.0-.JfgKX~J4ff*5}:+1?i+/L,0/0)3 J*2*N*/10/IpK-/p3)3)3iG .}K/I//,0/hK0,0,0,011+1/i0.Kj޾~J0/e/Eff*!/~ zJ4z.P<BK21+1R J0,L1-gkgL1 <-/-/L,0L//-/,0/0. f-/-/,/-0~. <zJ4z.P .,00/0,0ef~rj  /f.'Z gIK02 Jo..|fF Jw f#M1iH0j.,0 .Mf iS.-.SJ-/-00~fg!)JgK-/Hi.g0,0 .Mh-/-/-/e/-/Y#/I/-/3L fh.hfgL$-1,00fmggm#.=hX2KgLL/eJ&f(!LK/-l~KLfugKQy.Jd<(4z.4z.P,0jK-/[i+10g/-/J-/heffgn..g/-/wu0-/,0--//ڈ1 J JLLfLJx.63K'/L{f_heJHJ0Kc1+3)30J~fk N*251zL,0LQ-K-K-/Nhg-0-/K/-/y<NtK-/Z-K-/-//-/,//0/-K-0-/L-/-/y7t2JK//,K/c11j*NG1yf t~f~/-/K-K-K/-/-+1/0JMKj-/e~.lz.Puu  ȇgKK,0K0,/1+K/gj"L,0M[ +1)3)0+MttMMc.gK-//gff..0 X/-/I/-x.f8  v<K n Jy"z J0,KKuK/-/I/-/J<x.6w.//, .s.10R)3s.30/5P l+1,-1L)/00 .,0,0LgP/v. .v. .vJ .v.jg-0,/K0i,0,0K-/wfZthtOgKo.s.R4 tQf!vJx g-///-/-/Pe/f| {hEtttJxX>g-/~J(1-/-,1-/-/JKhjIf/-/1KKww|}fJNj JsJJA=e1zgRLK-/}fZ-[u~=rh! ,0-/-ILrJ|0,2*2H0,J/-K-//L//-/o< xtJ//-//}@K!+ J//,//2J|i-//-/L-/bJiK//h!NKKfK-/*24%K-/g-/vJfKh-/N/I0!f/-/ fJ K/NK!f-1P$ #!NKl~81/-/h/-/M+kJ1/e/L/-/M+tf.M0Iw.N*2*2/KK"KgKxJ"Kz/-/m0,-.r.11 Jf,L,0K0HY.)fjJh-/h//-/jl,L,0@./LH0k,0,030,0,2+2+-0/0uJg f0,03o...0/u.0010-//+20)///0/K1F0-/01/1N ng1L,02*22L,1z.4*2Lx.04 .IQ.K-/-1-,10-//$yf-/-/-/e&..gJ2K-/L/-/-/-/2uJ/-/-/-/~3/QJ,g0KJ ,0,0H0M+1//-/-K6ghg-//dg-/uJx<2JN.2JN.2.-Rx6 H0% Qy.PK-K-/-/y.4//-u. .u. .vfgn ic .-/2KIPgK$-/EfV.*.-U.,.e.1f fL0,.4f fJ/-KMz.12gQMn.QfLf fBu1/-//,1+///r. .r.J+fU.+J~JM f .w.1+/nzJ4zJ4z.JK-/zKe/zfgzKe/f-/ $-/p-/z-/z-/-/KI/gxJK-/gE{fK-/dzf/-/I/Jf_. ._. ._. .3j+1h/^-//-zJK-/hd0xK-/zKe/zfK-/zKe/zfK-/zKe/zfK-/zKe/fsK/KmfKI/xJKI/{JK-/zKe/zfK-/ddddddddbsfKRxJMNqfdczK-/zKe/zfKe/~fKe/zfKe/zfKwfah@gzKe/xfK-/hd0czz~b~}zgbJRxJMNdfaz -/z-/z-/x$-/z$-/z-/z-/z-/z-/x-/z-/z-/z-/x-/~K-/zKe/yfK-/ge/xK-/ge/zz8-/-/KuJvJ-/-/KoJddxfd34vfg-/-/KtJ h/qJJc+0HLL,0/ /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits./lib/tildegeneral.cstat.hinttypes.hlibio.hstddef.htypes.htypes.hstdio.htime.hstdint.hstat.hctype.hlocale.hcommand.hresource.hshell.htilde.hsyntax.hsig.h8).0egz.4A0(WLvf0hgL/f.K/-/-O)J.Ks/-KjJ.0/Py/PwJ..MMG$.1+1jI/-/-/MG13)O0g-/J4zJK gJK-/K- fm/Wffh-/-L/-/a2*2*2L/fofmg-/KK-M/rJN/4z.4z.4k/IsJ~w. .)3)3w.23JjJg/,1+1,/1NFN*//2K2)L/00y.5L,/2*2h/foJm/-/e/I/-k,1,0p.N/~2/0+/0y.5gK0w..z1+1+1+1O3)3.3*s/I/0-LsJ/,0 .f3hMgM-*kvJgg2*.2".af/- fhy,0 .1Gu.21+/L/1+HJ.2Kg-/ tyJ/-4z./3+.1 i++z.#.1+1+1iiwfg6x.6MKEkIJ/-//VJQ.2fO./~./-/g_f1G1Mj*.1+.M fu5vfKpf/h  2*2LRI)Li~2*24wJ#h0,0,6fJQ+1NNm f1+g.d.NN J3)uJghqJ.nJJ/-/-K yJMG2*.3h~jIKfNbf-/e/1+.M5QI$$P0fW).W.)M /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits./includemake_cmd.cwchar.hlibio.hstddef.htypes.hstdio.hstdint.hcommand.hgeneral.harray.hvariables.hocache.hflags.hlocale.h</-/-// yf"}X2gM-/2y.10+06)0-2ZJ.2N-1-*01H05].i+i02*-K0/2WfkgM-/1z.1/ .w.0-6f.1+1/-/1)1-1~.i+11-//+01J.1L,/0/-}..1+M/-/1/- ./Jx./Jc..1+M/-/0///-[.i+M/1*/1I0Ik..1g//-~..1+/-///////-.oJ[J.1+MK////-.2*2*4.jJ+fu$.*/LufzJ1+1+1+11E2*.j1K tfgsf|f1+1/-1Fv/-/ן.5y.m2-3y./,33h/I0-z.lz.P4z.1///1-,>K/-g.jfhKR fa0fX.~3)3E3iJ .g6x.6 .s. Jt .t J2*2*2*21 fMKI/0X(fX.-./I5gVJhv<[<.K{1+.1Mz.4gLic~..~pJnf U.10,0KEg2&J.1//-.2*24zfh//-iH. .wJ. .wJ JNg-2/ fhyJ  JM+/0/-//-//0+/0/PzJn.K!Jm..kJ ~ M/0,0/ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsprint_cmd.clibio.hstdarg.hstddef.htypes.hstdio.hcommand.hlocale.hK+.MK .J.J-K-0f/-/l EMH0sfg-//-/f4L0,0,0 ./.y/Ff>E f-/$\ Jutg-/4At.@.|KilPPPLKKK_.gLhKK .`.2KKNKKNK JLh,./KK/-Ef./Kg/-fJ-/-/KK-If-/-/KK-f1+1+1hghhI)pt./KgK-} .*)3/1.KKJ.2LJ.2..2KKJ.k..Mn.3Lg:.F.53JM.(.KK Jw.2KKM+X.+JU.2'JY.2#J].2Ja.2Je.2Ji.h./JQ.V.J.m.2Jq.X.7fI.w.\fKI/yf44/-K2*2F.l. .00-Kh..l.h0-M.n.0,./-4LiKGkKifKKW/-/LhK0,zJ/-/2gI3mM$zfKgz.*8J0,/KK].K//K-K~.hK1G..L fKgKK-K/K-K/*) Jmf|../2*K1+//KK-K/L,0,00/KK-K//|fk/-KL+1,j.+k+2*/L/I/L+1/-/O2//-/-K .Lyf.*f1+}..KLKe .Ln/ML}d.KgKgKgKK~JK/-/-//jf~J.~J.K-/vJK+1,L2//-/-1+/00KKyJ/gKvKgiG3nJKgvZ6,/1,xJ6xJP/1L Jw. .w/ .0N*2O4,0-/ .L0,0 .MMf*K1+1+1+100N*2O+1,L40,,//00KKXJ;|./K2*/-N+//KK-K///-|///04zJ5-/0'\fgK-/L-/$1d-1EO)6(-/-/jJ/I/ J1+.1gKhI]/K,/-gMOQI):wJL~$/-./gI~f2*.N1h0,/h,05e/qJfKIw.myJ5q.~rJ  C.=.C.=.v..q..qfVZtJJokJJ3/-1+KL/~fOJfJCKK/-/-KxfK-/{D .w. .w. .I/h/f/-/-M,0LK fK"h1+1/-/02ch Xe/-//K-/g/-/3.m.gJ/f*frJ-K"K-/2KK fK-/~*5,0y..5,)3)mJfJ1+/hKhML0,/g/hg4f/O/ .v. fw. .w. JL,0/LKL/0,fK~!1+1iKggKhlgKM-/0KLJ\Pif/g,0/fw4z..l536x.)kx.65q..1 JOi5MhJf/|JK9fLL/-/B!MgP!f¼KKOKKOLghgh0,L,0"hgMgLgMg JOK3-/-~f.w./.w.g.1+1/*2+1Ru. .-)3)3)3/-/ghxK r./- .+K-/0r. .0K-/02d .K-K-q.tK s. .+K--2*00K-/02d5N*2g0 .tf0g/-/,0,0/KRr JgD  .t./ .H0+2*/-20O2tK K5y.5/x.5/1+/1+i-/-/IK1G12 .hL^K/.J .s./ ./K-K1,00 fKhsfK .s. ft.f..fJ.hfJH  .s./ sf fgK!fr/-K KM0,0/jhdhh\K-/4LLRi x#f|J5K-/KI/0+1ONK-/lhK-/3K-/M,L,0Q/-g\fQdKKrg JKK<f~sslKJefK-/n. fq.f!#KhhKggggggk0,1+0/0 "lNlRlM1+1+ML-/-KPi .w. Jw. Jw. ./LL0,0/#.^.".ii2*2*Ngj~feeJPOfK-//220g~f.[%fI/01+2/ .Jg gg0BJ J/s. .s. JKK)3)O)v..)v.J.0KLhjO)3g0hhKxfk Jrmzs. .*2*w. .w. K-/3 2g6xJ6xJ62*2?0,1+00,0//3)OKLip..pJJ0~J.~./3RuK-/6x.6.Lބg J-g#3O.3.M.1.LM.1.01c1+1G/00j0 /-/-K$f.{..*2)3{..{..3*2~Nfhz.KKKh}f6fz.4z.46kM-/~J/~.j0h/2*2*K/M.x. ֟X t. .uJ ./X|J. f+1+150LKkHL1#  fM-/1h/{fh2J!y ff%/-/.gJJ/PFK/,0,0J.1j/*f. .v. .v. .0mghLJ\f-/-/3Lih JggrJ/-/0~g0,0)1+O2K f5y.K/ik.KgjK~2*.jhOh-//wfgI/.fgL/iQfKkLnyJ  .t. . ./Iz.-/I/3)3)3!0,0HMi/I{4z.4z.4/ f*2Ke3-/-/-00,MIk..i,x.2*2*2*N6LL-/xhgKkJ.1K,uK|f.Pi0x. .+1-3K/im.L0*3+1-3N/i41+.1KvJ3)3)3N-/L-/KJ5/"H40H2l-Kf J f@k)31i0,M-/LgI!uez#N/ zfL-/f1+1+1+11KMd8cM/KI/J.1/-/M/-+g1+d.1+1/a.KaJM/LK-/KK JFggN3)3K0G JMuJe0e0Eg@ J30hlJ-/ JgOrJK/g/-/IKIm|.2*2Yf&fhxJ! J2/-//h1+/-1fjK>1+/-1j/-/g~/-/I/bfM+1MKIs.gg2F22*2gKFl f-/-/1m Jx.2gg0,t.gK .t.\f*2!g,NK//-KggNf2*2/hK KL-/5iJ[Kw?XkKhg/,0-0QL/-/.oJPL0///-/e//-KjJNsJe/I0-/~/L}Jk)30f.f1N*.g.Of fi.,ggh~hf}J1-/K2*/,0,L.J0JK~fJK~JLLd0-//g/Kן|.|..|..|./jKLm"g JfK,04KJK1+0h}.J-/Ih-/Ij-/IOx.NPKyJ}J2N4z.P,/-g,011+1J >+1/gh/-gPflKLK-//~KLkKZfbf.kք3.mK-/.JhN*2F{fu}KfKJf3fKpJ-/KM~Kf$Kf}gn4z.4z.4RzfL,0-/g/[K-/O.2gKKM,0M.0,0,0M1+1zJnJ1,0JJ2/g,0J/-/1+Khf2*2/4Ia.fwJ3j*2JmJ.g>a.+0,0[JiR0NgYg-//K-/1+/}3q.-/I/-J,,0 Jz.4z. y.0K/--//~.hMLJKgN^fI//-/JKMLJK}/-/hMH0 /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitscopy_cmd.clibio.hstddef.htypes.hstdio.hcommand.hgeneral.h 8.1KL.ij+///+///g-/-/~fig  fdfN 1+1hK+I/J1+1g/-MI/f1Mg+/0+/0/L<$K-/K/-g .EJ;F~J.~.KK.~./.J~.~.//,///gggJ~..~J.~.KJ~..J../-//K../.~J.~.//,///K-.tgg J+v. .P~..~J.~./-//gJ~..~J.~./-//gK-/~..J../-//K-/../.Jg-//-/,//+///k.1g0,~.iK/,///ggh(4 /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitserror.clibio.hstdarg.hstddef.htypes.hstdint.hstdio.harray.hvariables.hshell.hflags.hbashhist.hlocale.h01+1f}J Jv.60d0/j Lt./-//1+1*jI}f6x.6 f6wJ/vfKgLLf2K0,0h0d0/jr!tM+1Z0d0/i~J2/-/I)0Kw j3)/L0d0/IM+5*00d0/i_M+5*00d0/i^fM+5*00d0/i/-/-xJ/-/-xJ-/-/-}f./-= /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsexpr.clibio.hstddef.htypes.hstdio.hsigset.hctype.hlocale.hsetjmp.hsetjmp.hstdint.harray.hvariables.hshell.h.z./-/i+g00x KIl.///-.2*2-/*2I/y<2*2$KhfL/I/,0,0,L.J,..-/f.Jc1-+/-110L,0iiH1/,Jm-/I/a(4z.402*O-K/,0.~JM t,0Lhz. f//,00O2*2zf,0L+2-/xvw. .k  .w. .Ig"K/Fag~/-/0I.J30,00&^fLKg J/uL}JKMgl֠gf}5y..5/053R,Ly.f13MlJL.}..,}..}JKsKIq./e/1+1=-/-J1+LI1+1.pfh}! /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/syssubst.cwchar.hlibio.hstddef.htypes.htypes.hsigset.hstdint.hstdio.hctype.hlocale.hsetjmp.hsetjmp.hcommand.hgeneral.harray.hvariables.hshell.hbashjmp.hsyntax.hflags.hjobs.hpathexp.hKj-Mf.i t..i t..\f.1K5)30y./3/1|..1g-/z.0,0j0,0v.|J1+.1,Z,iLzfxwf.N/2 .2*23aZGy./  wJ-]f3/-Ke/-M/-MI/ 1+1g-M-KKg)3EnKl3).3Nj0,0,0F2*5r.q.Lh4*jz.0/ J0`f{v#]J+..Jm..m.5.kfi/hKof/-.g2/-M,01qf!/׵!1+.i .n J4aJ/e/rJg bf J/etJd///IuJ .s.J Jh0,0Kg=D.-hgKN-//KMLg'v.FJ.BJt<;pJ v.Lg"0I/ Jp..#I/Jf}3).OsJ ..IE..<sJ ."K-/aJrJ.Rx.Lg"/lf(JX.Rx.Lg"/J"f^J5h"K-/ .6DJ/-.K0!$_fnL-/..JfL/+6x.'J"f,0/LgK/d/K//sfJD"00K-/K`JfL,fx.0g10/ / fK-/K f3).3g1OE1/w.Z.%.Z.%f0H .pf1+1L)3ii+10 f/1i.i.d.m.m..MufxJ/-KQ+1Lg+1+1G~J2*2F4LL,0RG3LMij.j.jf.x< JLakL, J*2hg-/K*2*RJ3)3)30K-//.qfhMH00,0hgj.j.jf.qOd+1GM52*2LKgK)3)3E .~f2*4,L1M,01+1hKLk.k.kf.xX fhbvRx.6x.R0M  xJ0K Gf2u/_ XwJ0HL5JcJ-//n1+10KgN~f2*2F4MH0ihKKk.k.kf.n,0Fs1+1G3N*20jx.x.p.x6x. .1+1wJFLz3).L#hR B~.~.gf0H4g1\J Jg  61-H1-1f2x.22)3a3/[+1+.I/0g/-/,gJJ/-/l)p .t. .x.*j6M+1,Lq$hL-/3fK...JL,0Kgp.-hgKN-//KM%"q .v.h/-K11K--//fuKmg0qf JMeKlOm01KqJt64zJ0Ycz.400,0,00p/.KKJJpJq<qJJ:L,L,fqq .v.L/-K11/--//fq4/-/-/fK.Wgxggg-/wf .w. .w. ..0~f1+f*2s. .s. .*w. .2H015.00BJ'J1fL~.m0 JhiJQy.0KJ0//N*N5Lh"1gxJ fJL/-/K-//-/~f0K-/f.K?$L$ J*2y.12y.R)O0LiOLLhKRK/r.yff/-/-Kgb< Jv.60,x.n05 f0,5Mm J {.{.U/MrJwp/I/PJKfM"/-K-/|JJ|ffI1..R./-.Nf 4z..P./f JMס/y.5%gI/r .r. I/-_M--f  z-0IJ~X5y..Q./fi fJ *׾Qm J>KK-/K-/iM]gI/r .r. =I/-,M-- wfX[ fK-/--/L+fw QK"J+f1+12/-z. J1+1Lx.hgN/aSfN .v. Jr.2 Jv. .P/-/5$kbJgw..0KgFw/-/-P2 .t. Jp.2 Jt. .5gmnJ/-/-3).h/-//-/E3)RMLtfdtQK-/0,L.f\g-/1+/+ .K5y.5gK6x./mhf/-//1*/1[Jg-//Kh*2 ZKKKJ0,0f~/LvfQL-/-K}J/0+//K0K-J!i~JI/eff0J/0,Lh~fffhz.1.z.1he0QUf*.Uf*.U.*llffhSfK&JY&.Y.M/--/{..{.J{ff&tw-/Tf+.Tf+.T.+zbgK fxf"-JS./.Q.-fL/2)3+2*j25y./Pz.4Mht2L{f>.e..i-/1|MJ}.0J|<"LH6,L,0L1c6K4.Kf4JKJ4.|J`mh0,hKLfjNfM=/|f.|f.|.ա,01.N.1.N.1.khRm}2*/i/e/)3LM-/~.NJ=L2+11+/hh~gffj/IK2*23*4yf30L,0 OJLLh/-/-0KKfLjLf/5jK/-K+1////g0,/g{fPLKK/-,1-NJ2֠JJf5.J5.J.5JJ5. *.}/~`H00/4zJ4kJ.f   JKhJ5.Jf5JJJ5fJJ5.8*K/K/-I0/-//}Lf3.L3.L.30N|2.Mf2.M.2MJ2.(|fK-/K/*//g/~+J JMg~f1ihL-Kb~f}~h~k>+MG1c1GJLH0/J/K,1KKL-Ke/1g-/..J46xJ6/J.5y.5JKKbKf-0-/.KM/fgKKifLKl/0//.J+f.JgN/QK1+im~f2*.2M/-/-/-.g.|.M0 + f.|.. ./-/1M-/-/-/tJfKJ|f00.c..k2hfkJ2 .u./1+61+0/n.J#.~fNf..L0 ./e/M+1gX/QKLK-gIK00KML Jwfx.fK~J1+10LL,0wJ1+10LN*2J~ wf JJjJ0h,0wfhNb2f-/-/-/~fK-/LJNbf$gLKLKJ.~ K-/K/I/1Jf*2mf~JK/-K*2*QLK-/JM+1}fg4g-/KO fi3)3uJJ+1}..y..w..Y.2*.2.1ffiK,1I/I/M+1,0LhKuf~ M+1K yJKE-I/-/ /-/nJ2-+1/I/M,0/I/hf1+1KKgI/wf2*.24/yJk,0H//f.h..$gKLjf3).k7.0Jf0,0~J.~.1 /03lG.9.G.g0,0/LL1. JhgKE./LJif-//~fxX2*.2.1jfiL,0/-/׆,00hK2*.260vfiK,01+12/aVf0hK)JgI.6x.6x.6LhF gf\g=rJ|f(Qg-/4io"JTfi#]J(K,0/LL=ZwJzi|0,K-///v$ f$v||J02*.2 K/It./KQwf0Hm1+1.1ofig/0,00hK2*2*2.4ifihL/nb/-/KfJ .u. J fM-//-/0>!JP\f PW gK"f .KaJY!ffJj/-1LMLi"Mpf z03 /usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/includehashcmd.ctypes.htime.hstat.hhashlib.hhashcmd.h4./K/-.)3)3/-/i+1/-K/-/!h3)2/I//Kk1+3,01fhkktfJ/KzJE/kJl/LK~/-/ghf3)32#iIz /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/systrap.clibio.hstddef.htypes.hsigset.hselect.hstdint.hstdio.hsetjmp.hsetjmp.hcommand.hgeneral.hsig.hbashjmp.hquit.hshell.hflags.hsignames.hlocale.h.jf.gJ.0k.0k.0l/-/-/-0k.0~f-/-//|f.iMOJx.J .IJy.J.x2*2i-/-/0K3)Lv.f/-/-/0gmNK.wJ.}J/-/-/N,1-,4,,00/Kw-/-//g~fI/BjNNK-p. &iCI/0-0--/-1چNNieR &  .w.. .w. .43Mf+1-/-K-11+1/-/0MMKPG1+/H000,*2+3 .hL,//e//KcfKJkJ6x.6F/I//n.Jff3 v..sJk)3Z/I/~ .z.4z.4z.* .z.P#.`f2-,M)001M+1ikhh/0,0,00t/ f~//-/ MRLg!NFb.!!`J.II/.x./.x./.~..>f2*2l1+OkgLgv. .jf3K!KM1Cf:.1C./cJh=g/8+.16x.40,-/-1x.4-102h.h. ./I/<0,0։jJPlczfzJ2*2gi .`J/fgtlJ,0kf10//Nz.6x./)5GK//)N/) .$*N*Ki w. Jw.Kn+M+K0,L0H /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsinput.cstat.hlibio.hstdio.hstddef.htypes.htypes.htime.hstat.hinput.hquit.hlocale.hT&.hH0Lf.K-0gL.h?) +1./0JR..R.iG1,Jmf/-/iXgKJ/--07fxJfKKM-K00,0,0,0*2*2*2Q/xJiKL<1+12-/K/Km1L///-6/-/3[I-0H*l}10--0I/2*2-/-J..fPh~fK-/g3)20,*/1-/0.~ff~JP/>~1+1/KI/f+.MN-gl!I10~Jig-/K0LLcJ4<4z.4z.4g2R 1+1+/0L[J-/0-//  ./hK/1+~1+1i]-/0-/6Lg-0x.s: unwind_prot.cgeneral.hsig.h/1/-+P,0L/f.gfn.gfn/JdJ/."..gfn.gf f.+1MJgK~fi+1/K0/f2*PK/--0-0///L/JK../LKJ-K0eiK"J1+1iMkJk+1+10Z.r.n.kJNJ.1+1 wJiI/>4z. /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits./lib/globpathexp.cwchar.hlibio.hstddef.htypes.hstdio.hgeneral.hpathexp.hglob.h83.~fJNhcuJhK/,0xJ .MjJL,JkM',0,00-KiL/-/1lJ2k/-/0+0/,1H//u.uJ/_ M/-/LKe0/K-/-/_J>L)hKe1a f,0 .zJ4/-/-hK .u.r.2/-.l.PJ3)3N-/-/-g؜lv.X3.M.3.K-/KLhg JtfKj1+1G3MH0K-/-/0 f~..~f~.kXf,0uJgl~3)3E6L,0 I/f~..~]JJhlf).`Jyfn J|h /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/syssig.clibio.hstddef.htypes.hsigset.hselect.hstdio.hsignal.hsiginfo.hsigaction.hsetjmp.hsetjmp.hsig.hshell.h;J0JN* .x./5/KffvJ0,0z.4z.4LK1+12 1/gK-q.Egg,0.,00Ksf/.@J+1M+1M+1M6x.H31g-fz.1k12+1H-/-6"LiJ J/-KgN$.KhK~f4z.4fjJ/-/ w.N0d//4z.4>fJJ0M)///Ln.M*2+1)01l-/-gnJ/J^f~.Kkhhgg~.). iz /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitstest.cstat.hlibio.hstddef.htypes.hstdio.htypes.hsigset.htime.hstdint.hstat.hsetjmp.hsetjmp.hshell.hpathexp.hlocale.hlA.LhPJ .S.!fgJ J fK]Xj < .M .u.{v//fwfJ2*2kYpJMNL=K$2*2*2n3xJP<]<-?M<,`<`-<ffOXH<<z`m<2~2/fׁ//lJ-/-/LxJy/-// J//hRvg fuh fxJ0}G1MUf2*.j0g-/-/.2oJt GM/eJsW"G#FEyMxJJJi+1h-/Ky XP/QLm(ZJ+JM-/GtJaE4z.4z.4J.~.J#EfhLKMf,0hKzJnKg~fg/+.M1KL}JN*3/-//+1z.1/0g5y./ifJM0LPjvJKGx. .uJJi+1/MKI/JM+1+0LKRaNI+xfJPzJ40i/QLmf fK /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/includebraces.cwchar.hstddef.hstdint.hquit.hctype.hJJw. .+1+tJ J1wJ J f J JLL4~..~.LJ ..!<  J%Jkf/,01f/-0-1m<*hgK// J2*.21MKh+1h,0ػKF2F .u. Ju. LL,0g+.dJ|.6x.6xJ ./-/Jg/Lvf1.0,KI//0,04z.//2.f/-/e/1J-/ .s. .N/hQ~.J~..~..~ftXfgM/-/K~JKKSfK,JlK~.J~J/2*NN,00,0PgL,0h,0-K-1gLK5fK.5K.5.KaX .`._JKLLg8f M3)-4)2.3 2*N0I0L/-,1+hu.ٷ2Ja$ -/-/-/Q h,04xgl JM0f-/-Ki~f~..~J.~.Jھh x1i,0Mh1+Mw.xfo..U.3-/gdKf JKex3)3/jXh.#Lg.3KjJu< .ju< JCJ?J..4-Ke/a-KI/fk.L1+1/O0gxJK 4z..40,0,1Lx..1xJ.x.R.x.L-/gK-hJeN2tfg/-/-/,0xL,0Z,02ltJ .t. .t.f/^f0yN/-/g05y.Q00/-/ .w.,1LgL"/-/-//LK-/1f0hJh,0m-/M1+Mt./-0,0Ow//L-/I/1hK/K-//-//-/K  4z..4Lii5y.. .q!JKigKhO K/Mafb-//LMKKKJGg>XK-/0h,//RJKKK-/u.q.4zJ4z.J  J6, JfJf1/,0 "g0,0&Ca..{/~,  i..@h,0f..MKj/h/jg-//g H~2.l..l.J0L7f[fׄ0KN JgK-/1K-/0CJ 0J,0/K-/yJi .x., .KqJf...]f$fa Jb~-/Kg-++qJN///0*00/bJ2/).6x.N/10e/J0,)30-L,xJ .1gf-/KK/'(JuJ.gJ0.3/0x.3///00/1..J.y....kJ...dJ...]J.G..yJ.. .*///+21,t.6//1/,20///1b.U.t. .zJ4*--0/,y. .11L/0yJZ4z..4S./.Q./.Q. f0LL-/zJ3)LsJf/-/M+10Hh,0,0,L[GchH4Gf1+M--50<*20,/)300+/0L003}3)O օk*2G11gLLLM JwJb.Zf JsJ~/-//IqJ/-//IqJ/-//ITJ/-//IjJ/-//IpJ1,/KgK/0f2ML>N/-K1*2v.jdj /-/L+/03-0H*3/1,0-#J-/-/h0,Ld0/g/-/,1/*1/2/M/I0i-/L,C .*3-+1b/1/,0Kgh-3)3NNKOLnG1+1LLRG]1+1LLRG!1/-//I/O-f4jNKOL/2)/2/N-//-/gQgMKMLi-/0+zfmg Jq*40* .z.3*O)3 .g.. X/gfH0fgwf/,0,O6K^JMr*2*2f~JK/--0,//-2G12y.0d///h/e//Mj0d////H0,///N*21+11+1h)3)O1K-//-//-/ .u. .JJim~~/-/KLH W* list.cgeneral.h.0,MGL/+1+J. J+1iL /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsstringlib.clibio.hstddef.htypes.hstdio.hgeneral.h -./h*2*0gw.6g5/J~..1hK-1+PG+.2*.jL,0&fI^.#.]JJi/cXi-/ JY/g1g.%J1+1uJ_ t"g/I//hI .cJRJJgY  gp..p..p.f,0zJs g-/-M]2*.3)3/I//0,0WJN*2*NmyKOyfyQJN*2*Nmv.iKKGy . /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitslocale.clibio.hstddef.htypes.hstdio.hlocale.hctype.hsyntax.hP2*.2[I0-0/z. f/h+1J-2+-2wJKKq.LgN+-/2,,//0sJKI/~J1+10/KM,4z.P/-/)J[JO  0K-//K .`JiK-//JwJj*2 .KK-///dJ2*.2*/I//-h J h/M f/1dfI//e/L fK/-/ 1Pv. .vfK~0؆Nh./G/-/-/gKI/ag1+1+1.fJQQJ f=-/?JJK%.Uf fMJ?tiB,fiagJ?1+1M+/Lg/I~f4z.4/RKOKOKOKPKK-Ki.df/PkkT0-//g/- Co /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsfindcmd.cstat.hlibio.hstddef.htypes.hstdio.htypes.htime.hstdint.hstat.harray.hvariables.hshell.hquit.hflags.hM0Mma/F~JJ.}fk hh.3^J .G/f2*2*jN٠0,0/LQO3) .@kffbJ+eTJM1PKG-Nbf .w.. J1jL,0nL..-..-.JN+1Jk.0,0 .r.0011LMܟ/,0k..i..k.0,.r..i/iNJ-/(Jv-K-/TK-/~/LKQyfQ1pJ5~ML Dd /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsredir.cstat.hlibio.hstdio.hstddef.htypes.htime.hstdint.hstat.hcommand.hgeneral.hshell.hflags.hlocale.h(.K/*J*2_f"^.!J/-M\J yO/1+2*/3)L/I0/-0LgLzf1KI+20-/-/-0/2*2*20PKG1-//-/K1+0//+1+/*113*2.Z.+1+/,/13*23fo e/3[J}< 0)31p..0pJ ./4f( JMfw f .}fNLkhe/RNJo../-+,/3JLNK~/-/0K-/LN~tf~./OLMMLMlMfMRLLLf|Jl0,0,L/JihgfKKKJ~h/e/jg} K;J J JKJLMlLiL|gmkKK-//I//wfKg}JIJ|J"Kf g/._JNLfNM}f/-//KKf{fKg-/3/-/gLf .w. ./Kf|f~Jf|1+Kh/f}-JJ}ff}/-/{J~3)3)33fKLK-/KKfg-j.nfsf xf`Gf&s"*.N0/L1gLk /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits./lib/readline./lib/globpcomplete.clibio.hstddef.htypes.hstdint.hstdio.hcommand.hgeneral.harray.hvariables.hexterns.hshell.hpcomplete.halias.hbuiltins.hrltypedefs.hglob.hpathexp.hreadline.hlocale.h|.K3./K/g.M.4.5.5.42*2*2ؠI/-/-0-1yJ2*.2K-/,0H0c/-/-0-1wJh2*.2K-/,0H0c/-/-0-1wJj2*.2K-/-/I//,0Hi/-/-0-1yJE.3/0,3H0/I/-hg-G/-/0/-/0u/-/00,03igKK1+/-1}f2*2ghi/e/s/e/IK1I2nf.nJ5I/jigKL0,-/0iJigKL0,-/0Jig/-/g-10,-/0JJ3KL,/0g2*/-2JJ4/0H3H0sK-h0,0-PvJ./KLKL/W my.5yJQ/0,LKj .wf .PJKLKKLh,0!._J!.[fFJl/L,0KKibvKKKK}2*N0 0,PK-+|t3).3Z/-0FJ.gK-/zlz.0d0Y*2F f-K-K/iWfg1+2*20hLM-/I0yJgKf3)3EO1hM,0/>Kƿ,0hufxdK 4z.6K-//KKKKKKKKKKKKKKLKKKKMLggKKN\J=P .u.. f .u. .|JK-/K-//I0KfKj|ffk .J..L}..}J/Jؠ,0KgMKMKLk,1+1 J~f.~.L-/,0/-OL,00Kx.6h-//K-/w.h/e/'0,0iKKL-/1+i*R*/*g-/sJL,0.NhgKh fwJ .13l' Jwf/K,0KKef~fJ~Of|=MKLKhK>"Kh/K,0K}f/~JO,0/~f gK-/NJ|fvtJ/ J2/0,LyJ5hLM-/4afgKLL/e. /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitspcomplib.clibio.hstddef.htypes.hstdio.hhashlib.hpcomplete.hlocale.h`2.gJf?hJ2*2 f/xJL1+~f1+1/ .u.0/0/////2Jil*//0*//0-/-/-/-/-/-/\f-//,//00,/..+1Khg/KjgJ//KvJ.g.gf/;1+11/-Kg4+1*+1r.% syntax.c( /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsxmalloc.clibio.hstddef.htypes.hstdio.hlocale.h6./A./-//-/I1g"+.1h JsJhMK-/Z.10 JxJK-/e ./support/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitssignames.clibio.hstddef.htypes.hstdio.h7.mIJ}..~... .v. .22*222*266x.622*222*222*222*222*222*222*222*222*222*2 .2F2Qhg/H/*3)n0,//-0LRL ..command.hgeneral.hbuiltins.hbuiltins.c ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..alias.deflibio.hstddef.htypes.hstdio.hcommand.hhashlib.halias.hbashgetopt.hlocale.h9J3K,0.JaJ0,04 fQt.LhN/-mff.1+1/-//KLK-~)3)5,h/QwfzJ.LLJKKQa.n0MIiLO#.f.1 JKvJ.J ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../lib/readline..bind.deflibio.hstdio.hstddef.htypes.hrltypedefs.hkeymaps.hcommand.hreadline.hbashline.hbashgetopt.hlocale.h<4z.4z.4n-Kh0,0,00ZJMfQ./.Q./.Q..JR.<.E3) .z..MMMMMMM  KJ-/ JwJ-/xJ-/tJR-/rJ J-/J JzJSJJg+QgfK JKfhPcfcccf>KP[KP0Pg-/LgKw0 .../usr/arm-none-linux-gnueabi/usr/include/usr/arm-none-linux-gnueabi/usr/include/bitsbreak.defcommand.hstdint.hlocale.hB0F^.1ih J#+s.hR<.1ih J#+s.htQ ...builtin.defcommand.hgeneral.hbashgetopt.hC2NLiNMQ0,00wJ_ ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..caller.deflibio.hstddef.htypes.hstdio.hstdint.hcommand.harray.hvariables.hbashgetopt.h@D fMRgI/I/h_e/'.3RJ'Jgif-/g$[ ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..cd.deflibio.hstddef.htypes.hstdio.htime.hstdint.hstat.hcommand.harray.hvariables.hshell.hflags.hcommon.hbashgetopt.hlocale.hXF1+1+1g/-1HJJ2/I/E302b.20K 'JVJx.Rx.f^LLgKg/[ypf~t4/-/0H0KLMtJhuJ4z.4z.4Pk)3Pz.4 /-/hK0/I .../usr/arm-none-linux-gnueabi/usr/include/bitsexec.defcommand.hvariables.hshell.hflags.hbashgetopt.hlocale.h|J1g-0-/0kJ6 Jf,.1+1M,LNmfjJQKLgjLK J f$5M{YLKL/tf*cfP/\f)kJgK? ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..exit.deflibio.hstddef.htypes.hstdio.hcommand.hshell.hlocale.h`..o[.%.01+1y.N/-/mI*d/-/-/L!M/I X ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..../lib/readlinefc.defstdlib.hlibio.hstdio.hstddef.htypes.hcommand.hgeneral.hhistory.hquit.hflags.hbashhist.hbashgetopt.hlocale.hz.4z.P 1+i6fK-/0L,0$zJ4dJ~f2O3 nJ}.o..o.J/.~..01+/K/~.&J~fpJxJjJ f,0M/0,// y.2t.4 .q./+.2F2JMLK}  JJ؟G}gK/}J/L <00,000Kl K JZhL>t +J~Jg~J8tN.JKJN w.0/L zfdOuf;ff .../usr/arm-none-linux-gnueabi/usr/include/usr/arm-none-linux-gnueabi/usr/include/bitslet.defcommand.hstdint.hlocale.h3)3 Lbj*0bj*5Lj2*20lN*LQi+M//HOX3)3g0 /yJ-/I//ici-//.0.f3)3"i/-/-K_+fJe,2NNNRgkfJ/=JJN!J  fK} \KLMKfgMU|hb)"OKL+1hNG1~J6x.6 XPz.4mJh .u. Ju.,2J`Jm/M+1-K-NRgfl..CM"Lyyf~6x.6 `. J .fka.y.h,2O J JkKM0H.}J.}f/QJ>Hf6f/-KJLd00g@fKN/gfcX,L0,0I/-iEk,LKem-fI} ./usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..../lib/readlineread.defstat.hlibio.hstddef.htypes.hsigset.hstdio.htime.hstdint.hstat.hsetjmp.hsetjmp.hcommand.harray.hvariables.hsig.hrltypedefs.hkeymaps.hsubst.hshell.hbashgetopt.hbashline.hreadline.hinput.hlocale.h .{/-/g/IJM0M+1H0,0/-/-,1/JLgPzJ0jF{.4.LJ4.L.6.Y?2J|fZfJ.Ww. Jw.f3)...J/M+1 .MuMK NlfihhL1/IK01++4/)3)2/0+10)0|..|..g1+1+Kh Xh. fiKe.+1+/-Mw. .w. ..g2J1M+16ii fli/-/-0,//5)3LhK}lbVJQJ}..}.fMg/,///1+/00Kg/-}..-0}.-e/-KkJ/p'ie/-f~J~KLJ}Jh/g1KK~fJf*2",0N+M+15KPRJ/.Q./.Q./JQ.Lh `KK}fm"KXgOLLg1LEfJ~fh//kg/-gL g~Jf hgN//-KNJ~u=J|J\J-/LghfhK-/N0,LJ~ig/-gf0{V/-/ ./usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include..return.defsetjmp.hsigset.hsetjmp.hcommand.hbashjmp.hlocale.h7K0,0,0Nzfh ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..../lib/readlineset.deflibio.hstddef.htypes.hstdio.hcommand.hstdint.harray.hvariables.hshell.hflags.hbashgetopt.hreadline.hbashhist.hlocale.h.v,thJ/~f/,///MLcl/-//gLGKLVffrfK/ICJ}"4z.4  t-/-/0KK-/-x.0,0>,0LKK-/z.4z. JhLN04z.xJ64-/-//KL/IT.g-/J}2*2Zv.w./1+1+1>hr.yNbQ/GH3 J*2.-r.LL/~2*2/-LTf./02*2*2*2 f-/rfhhK/LqffG3)35/M/Jo..2fhOO0PL  SJ%J/-,/0//mfg~J/L/O~J/L/.LNPefh.hKf .gf.. 7 ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..setattr.deflibio.hstddef.htypes.hstdio.hcommand.hstdint.hgeneral.harray.hvariables.hbashgetopt.hlocale.hD2*N/#JK\2"/-/-0*2i,L0JufgOKePef-/~5y..QK-/M/////6KlR]f KgbKI/12b/gLN-/gmfu-/Ji&<.1L2} .t.. fg,0&J~JH.LL/i/KP.L0,0.iL/iG12 M-/-0,02h0,/K/-/K//0,KK/ JIL1.J~M;fK/0,0,0 JgAh/-0-5L/-L2hKyt fj~tJk.J .../usr/arm-none-linux-gnueabi/usr/include/usr/arm-none-linux-gnueabi/usr/include/bitsshift.defcommand.hstdint.hvariables.hshell.hlocale.h63)30,L0Oxfe.5iIM fw.1-//-0-/hJw .../usr/arm-none-linux-gnueabi/usr/include/bitssource.defcommand.hvariables.hshell.hflags.hbashgetopt.htrap.hlocale.hp2hLL8JMJ#Khh/gg3 Pfkfgfgg"/-//0I)\1 ...test.defcommand.h5y.5 .gMrf sJh N  ./usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include..times.defstdio.hlibio.hstddef.htypes.hstdio.htime.hcommand.hresource.hx;P1+Kh fxfnzflbjtf .!.  ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..trap.deflibio.hstddef.htypes.hstdio.hcommand.hshell.htrap.hbashgetopt.h$1+1+2MM+1gIx.- JsJ~.3g0JJ).2*20K  &v. .j &JL.L,05Q2JQ)3 Jw.hL]J../;fVJ/-ODJ  Jp2 ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..type.deflibio.hstddef.htypes.hstdint.hstdio.hcommand.harray.hvariables.halias.hbashgetopt.hlocale.hH.r.R4~.LLOkJLLOm0QLLMMsJ~fhLL J.~...JLLM>f~JLJOKLLLK-)fKQhL/~-f)ffKtff3LKJ)fJ)SJgfff}"2 ,0O$KofK,0P JijJJbJq.Jp.L,.L v.N1+gg/FGJ/ZJKKKxKS ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/sys..ulimit.deflibio.hstddef.htypes.htypes.hstdio.hcommand.hresource.hshell.hbashgetopt.hlocale.h,.g-Nfzf4zf4z.P0Qf/5y.~.fIK-K/I/e/JfK-/M+1+M0QuxJKa|X .w. .w. .M#,1+1GONhg,0Lg-/IKgJ,.0,0 .}ONN8JJ<0,hhK+10H0Qf ּgg-hI/-LKKifK^f/f/H//vf\fKh,0  ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..shopt.deflibio.hstddef.htypes.hstdio.hcommand.hshell.hflags.hbashgetopt.hlocale.h\+1*o.3 ./1k..k.K-/K-/K-/,0M+122*23,0,0nf1L,0*L,0mK0~f1+1+1=b f/-/- J*.2 -/-//t.hg5w.0}fm-//0 *.4H Jhg4z4KLKsftJrZ/-//F .f1+.11/PvuJ fuJ3iJ2Lcf3)3/-//-L}.2K,0<JRJz.,.,0,05h0HO~JPPGJJrhg-/4LL/-1~MN*. J~Jlz.. ~ JNJ3J~J~..vK3 ./usr/arm-none-linux-gnueabi/usr/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include..printf.definttypes.hstdio.hlibio.hstddef.htypes.hstdint.hstdio.hctype.hlocale.hcommand.hbashgetopt.h.M+2-/0f1g-K0}J4z.4z.4z.P</-.jLJ-/YI-01.eJ.e.VJ..xJ..O..>J0H .J..L..L?.A.L=.C.L;.E.eJ.JR...RJ..L,hLH,14zJ0~./-J2*2{..{..{.f{..{.. Jihk5y.5y.QRM0L tJ3yKJi1,0,0+M0K-KI/MI1N1/-/-K*MK4N0,Lnr.n.-KI/} .vf .vf .5/-/n,6 J-/I///-kJ01+2-2-K{j-K{f{..N-{C,00,0 JM-/k/-|t3/0+E6x.42/JJ}JIKx.L,04$0,hfh,0fn JL~,0m0&}J1/~ 0JQ\MfMG9m 0,2,,/-2n|LI/"k( ~JW.N~/-/L J//M!Of{..M/-/-/{..2|JL. K-/{.{..{J.0)|.|JNPiTk/e/K-/m|f/g/eK0-/&|I/~$"|JUXLt~/-KL,0,0Q{{..{J{..{..Q|I/$2ghK,$I/`$ x*fPf1+1+i{1+1+i c~ |KJ~J&/g}/hNNH/KRK.n*k /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsgetopt.clibio.hstddef.htypes.hstdio.hlocale.h/-/gX3)3,+10,+O f4/--/01)01tc.2?fJ5f/-/IdJd./-gdf-5y./4+2fh+1Js fK6JuJ[-//,0"3 ..bashgetopt.ccommand.h !geJL4z.4g/0P//H0,/O-KJJQ,0/KK/-/1+0/-K/f@...-/ J-g0L-/-.f-/I6J//-/-Jh-/-lJkN/-/.Kxk/-/zKK-/-kJg. ./usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits..complete.deflibio.hstddef.htypes.hstdio.hcommand.hhashlib.hexterns.hpcomplete.hbashgetopt.hlocale.h %Jg .T. .t.-J_Jt.-JSJ-.1t JMJ+../-/0,MJ..OJ1.Jh.. JhJ.JJJJ!O"^.nf4.IJ7.FJ:.CJ=.@J.J.J.J.J.Fj*Gmy.G fv.G fs.Gfp.Gfm.Gfj.~J....=Og.GwFK fK$5y.51Pz.4)Ee/k/-/LMLgg/-/2+/0+/0-/!-/-/-/!-/!-/-/-/+1 h0MLLf,0-fgJKmK".J.NL1KKKKKL1KKKKKKKKKKKMKKKKKKKKKKKOYYYY[MKJg1`.~.3)3 .E,0aHKKk/-/Q+1+101+JbhgNy~fJfO h-JV.*.WLmf fJtJ/-/1,0,0-/!-/!-/-/-/-/-/-/-/,0M1G /usr/arm-none-linux-gnueabi/usr/include../..getenv.cstdint.harray.hhashlib.hvariables.h5/-/nfC2*.Njf KLP/z3)3)34K-/OkgP/xf1+1+1.6aJ/L?K- J>hI <  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsoslib.clibio.hstddef.htypes.hstdio.hconfname.h81 fQJ1 J/r..0/ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitssetlinebuf.clibio.hstdio.hstddef.htypes.h86f /usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/includeitos.cstddef.hstdint.h89KiJKJMfJ1+1ן /usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/syszread.cstddef.htypes.htypes.h9fKm2~4NgF.2*0PZJ?-f11 //htJg/-1,3 X /usr/arm-none-linux-gnueabi/usr/include/bitsshtty.ctermios.ht;.hh 52y.j.2i.2.1n..1/ ...,04z.4.-0,0H6..,02*2../h/-/~J0..1+1k/F=-/]1+1k/F=-/[1+1k/F=-/W1+1k/F=-/Y1+1k/F=-//ggU./Kg f  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../..shmatch.clibio.hstddef.htypes.hstdio.hregex.hstdint.harray.hvariables.hx?0.n..n..n..o.i.-Mf J}3-/OKM+1HL3} J0,L/M : /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../..eaccess.cstat.hlibio.hstddef.htypes.hstdio.htypes.htime.hstat.hshell.h0A/-/-K3J}Yf gI/.}.}J~..~..~J.~fhL K-0g0iJO f /usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/includenetconn.ctypes.hunistd.hsockaddr.hsocket.hC.P/I/0feJr /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsnetopen.clibio.hstddef.htypes.hunistd.hstdio.hsockaddr.hsocket.hnetdb.hlocale.hDJ2g0+/1gOK.,hJ.0y. /LMMfh*0hr.hhKryfK-//KK-f /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitstimeval.clibio.hstdio.hstddef.htypes.htime.htime.hE 0IK-0,01-L,2+2-35,0I0,0,00KMQJ2L byJ5)32u.52z.2w.32y.1N*2y.m*) .*)32w. .F2*2*N*2*2*2*2*2wJ f/-1,0E10), J +10E3,0g0Mt. .0/-/-/ J31p! makepath.cH2*.NlJ K,0L,0-h/-/LKLWfK J L/iJKKK     /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitspathcanon.cstat.hlibio.hstddef.htypes.hstdio.htime.hstat.h|JJ3f}J4z..4z.4ND1i.J0/I0(JKK#^.-JAJ?.A../g3 fcf-0-/lEJLJ0v/-1fM/KKC) 0-/l"JfDJ'f /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitspathphys.clibio.hstddef.htypes.hstdio.h|Mf3 JN*2/,0,0L!I XL/-0JggmyJ Jt.JJRK-/ .1/-/Kh cfufKfhXK-/ .,0,0# JL!IL J/O/-1f1+1 JLM .w.0/-/R_J!eJKLvf 7 /usr/arm-none-linux-gnueabi/usr/include/sys/usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitstmpfile.cstat.hlibio.hstdio.hstddef.htypes.htypes.htime.hstat.hconfname.hdR1+1`.%tfKN^/-/fwJ-/i/-/i/-/Md j*NKg0H0F2/-0,Kgw K-5b tJ2/hMdk)3Kg0d0 f̚2//-.}.Kf}fnf- /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../..stringlist.clibio.hstddef.htypes.hstdio.hcommand.hexterns.h,V1+10/--.3Eib.2*.j4KK-/-0,/,20tfKpf.c.1+10Y2*.N!ZMg-/0Lv. .vJ .u. .u.L,0K-//KKlf-/(f10*//l/Lg//-q.//PfjK- .-w. .0,0tJL,0KI2a5y.5/-/sK-K-I1+1yf^f2hhhK-20/*/101+.11nzfg-/-/-LyJ .vJ.1+.12-/L Jxfg-KK-hKuJfqJ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../..stringvec.clibio.hstddef.htypes.hstdio.hcommand.hgeneral.h]61. .+11-/M//-.3).3./oflxfRx.LK0,0xJRx. JI~J..J/,0KIh-/-/-Ke//-N,3)10J.30׹/-/-L1+1../-tJK..2*21=x Ju. .KzOJ.\ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsspell.clibio.hstddef.htypes.hdirent.hstdio.hdirent.hafhL fZ,1+1bJJ&W).ԊLh[L.hsJ.r.MMPg gfu<b S1kf[  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits../..shquote.clibio.hstddef.htypes.hstdio.hsyntax.hd. rw.nJdJ.2,0ZKI1KzJ6x. .0,0s.Cf.2/M^.'Ld.grfWJJ2h,00H4Os.0,0vJx`f2FNK0g+1hgKFm-2+-2OJJ2L*00?I0KzJ6x. .-2+-2Kf.2L*00\,00zf5/xJ .-2+-2 /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsstrtrans.cctype.hlibio.hstddef.htypes.hstdio.hTl2*21yfg3J3)35.0IJiK-/0y.5,02h-//,K/,//cJ(fh-00*00q.4K_J JHyJRLtJM~J2*N.0JiF-/IK/L,0_.KfKzf/ .KI-0]f&f-I.;JEJ;.E./-/} J /-/00o .o.zJxJ6xJ6x.6x.0g-KLf& L,h,0/L/-/-//~f fI2,0,1/-KK~J L1JJK-/gKf.J....K-.<tBJxy K-/] /usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/includezwrite.cstddef.h(.iLL/0, .xJ0g3G (K /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsreadline.clibio.hstdio.hstddef.htypes.hsigset.hsetjmp.hsetjmp.hrltypedefs.hkeymaps.hreadline.hhistory.hrlprivate.hctype.h-/--///f/f/i/-K/-/4*2*3-/2*2v. ./u. .0u. .u./2*201+10/-/1q.4v.///32////1,1+1-/+11*/iK/02/x.-0-//K0,/,1-/-2-/-00,0,0/ggggrf.q..KLK+1-/M{,1+13+1/H/+mf1 ./r.1 .w. .,M,i,i,gghggggg f/~*1+1........ .t.0,0/3)3) .+1+-/12,JZ11M/I/I/-/3.MKJg~J.~.-//-/21/-/-/11 .zJ4++11/2ifJYf11Mp~|H+10/ky.1c31K*xJ.n/MmI/F0K+0//mz.4z./3z./3.2~JJh J~J J~JM5 f4z./-4z./34K0K1+K//M/+0/(.W.).~.,0/-J~..X,1,0-/ fKPff... .grfi<'fnP1+K0JJ.].~(/-/J).k. MKkX.M-/fJl.p.$\.4k,,2-/// JKh~ .w. .w..y. .Q/K/KMsf/pKg~2*2wwJgxfgK-/ fIl.2mz.Pu.340L J/3)-/3 .O -/-/O JtfnJ-/-/-/SJl)3)3)3N/fI/-/RO)3)3J40-/K0gOg1hKeI@z.4+/-/I1z.1/0/3 !ff-/-0I0/-/K./-/)3)3/-/-/0j-//+1zfK-/C=f1@JhgI///J?-/-3/I5!jf"jX2-/*.1/1/g//MvJtfjB1G.100H0 fg 2gJKL /hKgu/dfvJMl&fb,0,0KK-|J1G.10qJ rfl~ -/-/1c3b~/-//hJI.KgMhyJP<2~2*2&._ff."K fM/g0,/gK/i.fiF-/eKK/ fie///2/g0,/K//e.k fflfb-./1/-+1+f+1g/+0/-/k-KI//L-hysJ5-/-/K -/gLO)/2g00,L}/-//af//-/LLMlnf1+M/jOr]/-.K f2wf/z/i/-/i6b_J6x.6x.6x.60Mi0yfd1+1gkcsI /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsfunmap.clibio.hstddef.htypes.hstdio.hrltypedefs.hreadline.hh/.g1-/I/MI/1L*0+101-/I-K5y.30\/x.6x.6/w.6Ky.Hh,0 f  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitskeymaps.clibio.hstddef.htypes.hstdio.hrltypedefs.hkeymaps.hemacs_keymap.cvi_keymap.cH1+1/N Jtf .t.Llxf .t.Jf0,02/-/-,1-/+1+.fN2/-/-2-0-4e/-/-3Y.21/*1/I/-,1c1+4  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitssearch.clibio.hstddef.htypes.hstdio.hrltypedefs.hreadline.hhistory.hrlprivate.h//-/-//K,//0g-z.-/I/|<1+M./pJKi0,L/Lxf[-/L/Kz.f24o..p.0 .t./2/KKKMrJJL/-/-/-/Mff/ ./-/-/I/; /-./10I-LH0b/-./10I-LH0|2*.2 J^JK J0KK0,0jMeg0jf//g f1+1kKKEj1+1kKKE~.//0-K-//0 /-.K k jVJ/lbf)3)3z./-40/K-t.-/-/-/KnJ//.k.f./M,0,0ME3f.1KKOHKg-.f~.g/0,M)306+1+4z.2-/0HL/I/KL0,0,.~..JrJL1+1/L2KgI<w.0y /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/sysrltty.clibio.hstdio.hstddef.htypes.hsigset.hselect.hioctl-types.htermios.hrltty.hrltypedefs.hkeymaps.hreadline.hrlprivate.h\K*2 Jfg'.i=#$|fMFEJ1/1|KJgQfmJJ/#>/-/+0/0h*j*|J}.J}.g}3).5,LZn~.3)3 J J3)3J Jz/ W/-/jKKg K1+1fmJ0h,0ih-/-/MIs. 2*2*2JDJ00,L,0 f,L,0O}J}..}.s.02000.}. .0.}.4.~.1MMa..b.000000/LPMMJK3[K fE3 JLxJ~fKJK.r.Jpf 2*O-F31MK0,v.'H4z..4L/0,L,0,0#.]bWfgj*0L*00,00/-/wP[Vf"d(JwfyrևewJw. fJ+1+1JkJPgi f .u.. f2/0ׄ,L6Lg.,0,0,05NK0M+1K0h,0 f9 g-/02Qf d"$fQh/h/L/R <Zh/KffFhfK-/1-/-/G .JKsgK"w.. J0K/020,,24z.Kkn..<..q../-/ I/y.k. JKFjyJw.14z./-/3)* J00h Ju. L,|lJ.l.fjjjjjiL2FJJ/-K..Oh J JI/4NK-Y.).W.J(N5x.K5NJ I/2~+1+1!F2f+1+1!F2f.2 Js. . . JOl-/+0+1/*1/GL/I/NK1*/1c.OG1+//-//fK/-/0.XJK/-///-/$.hJvR.2-/g/-0-J0d3KhZ.iI/50d3g/-//H0MLgK0,0j.,K 2*2h(XJ g.*۠/5yf0K f2w.gK/ (2*2*2h/I2z< fzfhK1c0Mx f(/-/gg0z.2/KvKg*fHf JK-/0-//gkRJ2SJK-/L,0/{Kb K-//KK/-/-fP/-/gg0szJ40g//,/.000H0,0M1,L_.OQ<fJO+1+1+//-//xc.JoLH//fp./zJ V20Mei/-ff HL04j..gifEfOif(KgL-/WJ(X.Lh,0 .LL,L-4- JKeffyW^/I/(f*t..|JJO/L]#.].$e/ J/J0,0Atg0,0,LJN#{X2.N0*2N< a,0Uf f-/6y./4,0\J-u "K-/-/5sJ.10=H2 JJ30,0hKL,00PEO0b!fOJ5fgJQd0&K0g-Kqn2/-/gg0q.1/L/-.1+1+i".f0hN-I.-/0JN,0*/IK1-/ JfJ..f...Ig/IK-/-0-/lJdL0m f/hL-/0-//R/s" 2*2N-/$-/I//L,0Luf .w.. f J.JFNJ H1 fy.5Tf>.B.>.B.35-/KMf0O-F.:.2B.>.B..j ff fOj*NEKKfu.Kf.1+MLh$k) f..J3)10IK/nfM//-//J/JJJ3)3QJO $"~Nkt.2*25-ff}..}.1.}fj*/1L/-K00}J/.Q." $=2KMY-M-/M~XqL6(lKqJ,0f02b2z4t Gg".//-./-./}.k)h1F/K0*//01k fN.i,0,0ME3}JmhgI1g~t2*2 .,0,u. .lLgKgn.o 5y.50hhKI0/I0/I0/Q J~J $rf v<ޟL fxf"PrJ1G1gM+1gLN~gc=h/-K-//-///-/ K-/1 Mc/.b/-K-/Qk0,LKhb -K-///)f/-K-/kKe/e K[zf/~ JL/HL,0I/~gI.2~.g/IJgL,0h-KgKe/-/I0~2*2g/-/-/1F.10hKI/-{.i+1 .-y.5/x.+/ ./y.L//vJ./-.+t.00/00/O2|..*2|..|.//,0LK0K@K-/e +1+31g-/M0,h//.}.0+/0.ftJLgR/-|. fKXw..K # /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsdisplay.cwchar.hlibio.hstdio.hstdarg.hstddef.htypes.hrltypedefs.hreadline.hrlprivate.hctype.hK 1+./N,0,gK-1+0M,01+1iIi//-gLK0L,0-/02*00,/*200,y.1+0-/0+10+11x.60x.6xJ6z.4z.4*3)3+/0/")3a3MgkvJ/-/khh.gJ0qf1eMnf.gf/KfK/K/KI{J1+1٠/eO fEן,gPlu~,0,0.fwg- .-/-/MXۆgg{fX<1gI`t~,-K0 ..+1c10,+3-*2b20,*4z.4z.f.%mD-/-/g-/I/fiK-/n.n. fw .wKRlzfJxJgg{JhK&Lg-/-$L}JfKzg~(>JJOjzd<<-/-/JH~Jgy1+1+1L-/I0,0J f.gxB-/-0--0]Jy.r..i1+KLxJ6x.Ll1my./l-/-/Phgj*6F2b2 .u. .u. .u.7.T. .K0v.Lm..m..m..Tf,.T.,.T.,.T./. J'y.5y.5y.Q3i jKkh3)OJQK-/e/")&~JK-/5y.5)O)3Kfq.J@)3)3J0 JKO l-/,/I0 |Ji<-/-3)z.42v. JI+2-*2 JxJ6 .LjKj*//#KI/ K-K-K-00,015y.Jp./0 .q.- .x.3)31z. .s./0,1-/01+/0,02I1|JI/I/+OJ Jܻ0,//I/I-0.-/-/gI/`J+0/ }.f/I/-lZ/-/-/gK-/3J/-/e/F-/,//}.fI/-3JfQ3)01+M-/-/Ige/0N}-/g-J} -Ke/JZJ< }p~/I/~f,0{fKJ{gl,0e1i2L-/--0,L4-/-Kf,|I/gI/AׅK Jia-//g )3Og .hgJs. .sJ1 .sf .v. .v. .؃} -K-K-Jf1+M+1|J-/I/K-/f`i+1gf1+1+1 JKzf E wz /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/syssignals.clibio.hstddef.htypes.hstdio.hsigset.hselect.hsignal.hsiginfo.hsigaction.hrltypedefs.hhistory.hreadline.hrlprivate.hȌM0//L/0I.1+1 yfKafhK//0I~J4z.4zJQy.4-2,/Kgb JjKLI .w. ./zffLghiiiil*2*2MKz.Q1G1mfy,/-/ghI~f .s. .s. .K1KKLh . .s.u. .u. . .1K fmkf.51hJJM- /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsutil.clibio.hstddef.htypes.hsigset.hsetjmp.hsetjmp.hstdio.hrltypedefs.hreadline.hrlprivate.hctype.h/. ../-w..U.W.[..q"K..i+1u/-//H2JE3)31/Ke/K0,0J1x.31,0lʈ-/l)3 .mJPLKKe//KgL[JKf/-//I/+1+Q-VfO1_f/4)//0/-/-K/-iKI/^..1>lfI./1>)-  /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitskill.clibio.hstddef.htypes.hstdio.hrltypedefs.hhistory.hreadline.hrlprivate.h̗...k0,00g-NLLP0kKLxfgqf/fh.0x.6xJ6x.61-//-//GM+/.gh*hp./g-Kge0ae<../gy.c1c/--0 XMq.h1+//,0/-+1/|X3)3)3)31 K J/I/LK,05KhKKlfi+1+1fL0,0oJKhh/-/-sJd11+10K-/00,hzJ#1/0z.1/0/N1G12L/1q.L3E30L/1l.1.,. ..1.,.A..}.*.N41+1L0,hJ/ .zJL-/2*/,01L+1 f)OHLK-KL/+1Gh,lzX4ZH1Gw.Jg3)Kc..1+1 f)OHL-/-u-/-) Jgbnj/0-/-/-//K01+12K0gM2*-//MrJ.rJ1+12K0gL2*KisJ .sJ1-KKM,0~f1+12/-//gL2*-//MtJ .tJ1+12KgKgjtfF.pJ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsundo.clibio.hstddef.htypes.hstdio.hreadline.hȣ.ia .J Jj2*-/-3)/24K .,1+-3a/1/0LihJzJgxf/-//v;5,1+2b1*30 /Mj3]J/-igtJ~1KxJ,0,0/LxJ /e0-RJi+i4E5 JM/g/f/e/K0,hsf/e/K0,hfI.Kk0/1~Ji"k3hkE/-/2Mv. fLxJ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsmacro.clibio.hstddef.htypes.hstdio.hreadline.hrlprivate.hĨ1+1///-/,/-2/S./1,0,//-K/l./-/i+1/MxJ/tJj/-/-/Pg-/-K-/00,MIw. .Z/-/llzJ0rJe/-/h/N,0,L,LN,0,0G2L1+1,0,-13-/--11gG 1+1i>) f3yf/-/-/1/K0-//y.Y /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/sysinput.clibio.hstdio.hstddef.hwchar.htypes.htime.hselect.hrltypedefs.hkeymaps.hreadline.hrlprivate.h<1,0,0/n//i0,L,1+0/M./h1+K-0Kj/-00J./i2-/0,-1,1-z.20/-0-/,01-/-/0,0m-/-/.-17fJfJ XJK(.rJ ~  .v. .M!0,0+/-2/,0.MKKLf+3,0,0)100/./fJj*2h-K~f-/M+10,0+/-2/,0/P/-Kg-K .M .y./4/LL/f~m,0ghL*fgfmk).3Kg/w. .-/w.0//IKMy.2 .4z. .w.4KL wJ .tJ0gK-/00/3).uf0~J2K-//-/LwGKKKE3 /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitscallback.clibio.hstddef.htypes.hsigset.hstdio.hrltypedefs.hkeymaps.hreadline.hsetjmp.hsetjmp.hrlprivate.h./q..1MH01i.-,1-/,/--0-01-/g3G1~K0,0,0Ki3IOK JO J Ji+1 JYeJj+1LL,0g2,0KFJgI/&-K-0//jJwfh/0MJgggdJgKI/vfn*.///-/-M--6 /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitsterminal.cstdlib.hlibio.hstdio.hstddef.htypes.hioctl-types.hrltypedefs.hkeymaps.htcap.hreadline.hrlprivate.h,/.K/-/-/L1i+)i .J-t.J]-/Hlt.i<3)3hj1+1g1+KPGG1KeMe.. J/.JTJ+1+10l+b4++11,0K/}"J ./ ./6w./- ..gLgOh1+K0,LgMJhf0g1+15Q+1x xf0m2*53)30,0--gRz.4zJPx.n.z.4z.4z.L,02Jp.K-/.r.Jr.-/-/-/-//-/O)3//-/..tJ .3/-/]J0H01`Jx.x./-.......-//,N,,//0+/1L,0*2*2*2MKff $,0txI/g0}/-/-/M/KM-//,02u ./-/nzJF2Hs/-/gIJ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitstext.clibio.hstddef.hwchar.htypes.hstdio.hrltypedefs.hreadline.hrlprivate.hctype.hdKtJ0Q0,J0f...M+1L.nI/I//I1PyJu-/M2,0,0,04z. .2*/iu./rJ.h.-/M0lzJ .2*/iu.KyJ.o.J5y.4/yJ6-y.400{XllfJ[#?*PJI1G13NF2>.NKI//MgLQn..J4JMSfJ/J@ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bits/usr/arm-none-linux-gnueabi/usr/include/sysparens.clibio.hstdio.hstddef.htypes.htime.hselect.hrltypedefs.hkeymaps.hreadline.h5/-00O/-/-/ JhJKg J`. JpJ .uJ-0/OJ1c1,00,2)2/Kft/-/0nxJ2hH@ /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/includetermcap.cstdlib.hstddef.h\8.*/1+#F4./-KKf .t. .t. .t. J/QMH1+1+1+3O1Lg-m0-//-K3-/iG1/eLTJgeJ-//Kh/O Jiw.{/-/gl/0MH0J5y..5N .w..,L6 J .`.,00/-/.`."f0,1Lef/k/+1+L0b .GhU2 Kf-K-/KMG/-J/0MH0J./`. .-1^."./ nJle/-1+1gL/-/gfJ .t. fihJ..0Je/6/-/1/L+.J///AJ...LJ..J-/ge/-LgMfLe2LjPz.iibL0~J JJh f-//-u LeK0-/-J-/-F-/-UJ,0H7JE  Jg/-@f.yJY-/-0K-//I0/I0/I01+3FN*~0,.LN0e/geN/0+0+00I/KG /usr/arm-none-linux-gnueabi/usr/include/sys/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/usr/arm-none-linux-gnueabi/usr/include/bits../..glob_loop.cglob.cstat.hstddef.hwchar.htypes.htime.hdirent.hstat.hquit.hdirent.hG.6/-K uf/-Jv.nfJqfJ4jN/-K nf.4fqfJJ/_fL,0M0myJh/L0,0H0yJ .NK/1 JBJ/LLH0yJ .fJl/LK~fv.9fKfg1+0K/PM+M-/M m.fm.M1)01//g~JgK yJM-h}J.~fMFJe..jKKPI/OJ^.".z.P0HM+11l/y.M2*2O]fzJ6-y.6qJORKr.J~t8fKk6x.1+1+M+2M/-/-/ KN f}f}./j.~JgJ~.f~J.P.}g}JthK-/+5K-/10/}t[f2fKLg/I/.JTLKk~Jt}J"Kmy.50MOgu. .M+/L,0PLkNb.iLnh,0g-iM-/-iM[f)f-ilfOj-/KmM-hM#~fKLH3I/JN KfK;gMF2/-/0LIK}_ /usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/includestrmatch.cstddef.h|X2J2Ip.J2I= /usr/arm-none-linux-gnueabi/usr/include/usr/lib/gcc/arm-none-linux-gnueabi/4.2.4/include/usr/arm-none-linux-gnueabi/usr/include/bitssm_loop.csmatch.cwchar.hlibio.hstddef.htypes.hwctype.hstdio.hcollsyms.hctype.hX .w. .LLhs.JGJ3w .F.3iJL0fvJ/ JFt5J_QEgw. .w. .0Lhs.JGJ3w .F.3iJL0fvJ/ JFt5J_QeJ}4z.4z.20 "uLuJ1+/0yJm*.N1/0G/1-/~6xJ6x.R6#-/03) !i >1tMf" Ll-/0.~J~.~.Ji~f3~JRg-g.q.1 ..1"h1QN-/0v. .,0/LP0 Jy50L~J .6JLj*2%hj*2~.k?N~f h,0-/ ./LGg.~Jih0LghL,/-/gjF:.F. /0,0F3>kgL$JNMfO/-P/-0ip.Mj-/J/LL.}J/-(x<?<8)[JI.7.73~f1~J!K]P&#<RJ } 0.LJg<,0J~f  zQ J.r..rJrf./O6H6P.SJPL-/Kegi//-/ XCJPL-/jMK-/t$"fz.lz. .!-0NgrJrqJJ5y./4*2*211G/*J=hJzJ1c1+1MgI/J4z.4,*4$~ghuLf1+/0~f6xJ6x.R6#-/03)k ~.~.Ji~i3~J3 i >1XMf" LP-/k0.eJ?.A.?6-/.t. ..1"h1QN-/0v. ..3}J.6JLj*2i,0/LP0 Jyf5LL}<.kJh_ <}.T.M+1.+1+1,D.G10K f0d0/ JgIf-0-3kfKKtfKKf~f3).k Jh,0.bJ)3)3b.ff.0l0d .jf&.zfCJh,1efg-0L,0c10,0/ f- | (DDdH DHȃ0DPHHD ؄ ܄X4hDH D (PD PxLHĈDD DD$|DDD 0DH $ܐD D | `,DHD L xHDH D H  | ȫ Ы  DH 4 D4 x @ Ԭ< D T ح  04 d8`DH ` @D PDHHDH\ D|lDHDxhDP0DD0DD@hDHD,D$зD$ H8$D$ H(DH,@` D$D!D! H$dD$ H($` D$Dh $xtD H0$,D$ P(HD$`"D$Hh 0hD DD <DDD DD0DDP$$DH H D$ |D$ `H ` p D  DH (D D L  | 08)\0)H 0*H 0*t 0T+T 0+d 0 ,DH 0-DH0l.D H0.HX 0/D 00D 01D` 02D0\3D H004D04HH0 5xD H05HD05 DH05@DDp0,6,D0X6$DH0|6<D 06DH(07`DH0(8D H08,D D0:D H0:DH0H;DD00;DH |  <D H $=TD x=<D =LDH >XD H X>PD >8D H >(D ?0D 8? H? X?8D ?`DH ?$D @HD \@0DL @0DL @4D @D P ALD H BDH BLDH BLD H CD CDH $ XElD$ H8$ GD H0 HXD ID ILDH$ lI D$ L0 K$DD |  KLH K L L  4LD H, LDD,DH  N@ N0D ,P,D XP4D P P0H P0H QD H QLD QD T D V8D @VtDH $ ]D$ \( _D  `<DT H`DL8 0bD H bTDP   d@D H `dLDH eLD H eLD H DfH Dg<DDH  g4DL | g|D 0hD LhpD H8iDHiHD(jDHl,D t+> t+(> t+<> t+@> t+D> t+L>t+h>dDHt+>DHt+T?LDH t+?,t+?8D Pt+@4DHt+8@4DHt+l@@DHt+@tD Ht+ A`DDt+A,DD t+D$Ht+EPDt+ GDHt+GDHt+HDD  t+IDH  | <.KX <.L\ <.\M\ <.N<.N8D<.OD<.OD H<.xP@D<.PD H<.QD H<.,RDH$<.RtD$ H( <.@T <.LTPD H <.TDH <.U$DH$<.VD$ L( <.Y@DH $<.[D$ H@<.^DH( <.h_$DH0<.`<H <.`0DH0<.aHD$<.@b(D H0<.hcXDH <.cDDH0 <.eDd(<.g8D H <.@gDH0 <.(hDH0$<.<C?D H C?DDHC@D | ElA( EB EC$ EC ECEC8DDE,EDHx E0IDT E$JD \EJlL EDKDH0EMD H EOD` EPlD $EdR D$ \(EpTDETDE|U8HPEUdDD | $GXDH$GXHD | hGY@hGPY$D hGtYDH hG`Z(hGZDDhGZhD HhG4[8DH$hGl[(D$D8 hG`,DhG`4DHhG`(DhGa4DH | HPbhDHHbDHxcpHHcdDH HLd DH HXe HdeXD HHeDH$H`fHD$H0 HgXHHh(DH(htD HidDH HjDHjlD HHjH H$l H0l|DHl$D$HlD$ HHHoDH4pDHHp|D HLq DH( HXrDH  | KsDH KtdD KtDH0 KuDH KvHD DKvDD KwDD  Kpy Ky KyDK@z D KL{DH($K|0D D($K8}DD$ H8 K|pDH KLHK8DDKЁD DKT<D H KDL K<DD( | $HND$D` $HNhTD$ H8(HN`D$ H | $ND$ P0$N\D$H@ NhDD | TOH TOȓ$ TOTTO@DTO\DD TOx TO@DDTOĔHD\ TO PDH $TO\D$H( TOpHT TOT TOl<DP(TODHxTO\H`TOD TO؝DTODHpTODHx | |DHH{>DD {4?{8?@D | $}x?D$ P` | 8}0ADH88}AD Hx | }C\DD  | }DDD@ | }EPD}(F@H$}hFtD$D@ }GH }xHdDD | |~HDH | ~|JPD Dx$~JD$H8 | ,|MD$D@D@ tQD | `dRD H$`dSXD$ H8`TXD D(`UD$ H | ,VHD tV VDH( W$8WXD$WD$ H8YDDY(DY(D$ZlD H$Z0D$ d0[Dx\|D H$\D$ H( | ](]0H$^D @^DH  8_ @_DD `xD`(D ` `D a | ,a D$D@D@ | dHfDtghDiD DjD PkD DkD | Tl\D HlD XoD  4tDH( | ,PtD$ LD | x<DH | $Ą(|D$ H0 | $DL  | ,̀\DD | \(D H | (́LD D T  | ą|D | H ܊$XD$ $PdD$ DDH$D$ P( DHXH 4D 8L  Th(HD PD8D H|D`hDDHHH dD P H | ,̞@ , @ ,L(,tL ,LH,8L  ,T(,|D ,`,D ,@ ,أ$,hD ,d@ ,$,ȤD , ,DH ,hD H,|DH,h<D,|D, 0D,PD,ب`D ,8D ,,L,lD,$DH ,,$D,ЭDH,DH,L,|D H ,4dDD  ,`DH ,DH ,ȴlDT ,4pD H,D H,0D H,̷4DH,D H$, D$ \0,4DP ,8DL(,@<H,|DL,dDHH,$D,L$,LD$ TH,PH,H,D,dH,0D,@D T,,XD H,0DH,pD P,$@DH ,d | hD\ lD$pD$ H( | 0HpD H0LDH0pDD0tXD | DD,dH$LD$ H(D HpD HD H@DH0@DHpLDD HX@DDD (DH 4 H | t\,tDDD  t tXD Ht@DtX DDtxPD HtDtpDDtdD H thtl,DHt,DHt8Dt`D Ht\D H(t\D$H | HdxHdLH@XDDHHD H$HD$H` $HlD$ H8H,DHD HDHH@DDpHH$HhD$ H(HLPH HD HLHHDDp$HtHD$D8 HDHddD H$H D$H@ $HD$ L8$H0D$ P8$HD$H@ $HD$ HH H  H  H  | P D (D H $  ,  8 HD  H P   D D < |DH \DHXDHhD HLDLDH(\D(DDDt\H\H,D ,D D4DP\DHPD$D$ H0 \DH<LPPD$D$ H` d" t"hDD  #8D\ &TD Lh&\D$&D$D( (\DH( D$ )D$H( .4DH $D/D$ H81tDH x1 11dD 220DHL2$DD p2 2DH (|:PD$L $<xD$ P(D=DH=D=8D H | Ȝ>DDȜ\>8DHȜ?D Ȝ|@D Ȝ@H|DȜH4DȜHDHȜID ȜK ȜK | KxLtDH|LPDD$LH$ MHPXNDDH N(NHD O4@O0DDpODTP`D HPD$Q$D$ L8$RD$DP U(DHUD$V4H$ T(X0D$Z0D$H0 8[`DH\TD$\|D$ P0$h^DDH(X_D_0DLapDHxbD(4dD$D $,uD$HX | Ȍ0DD0D H(4DD \DHPDD4$D HX8DHTD HDP |   DԒ0D0D40DdHDHD  xDH PLܔdL@PDDDlD LDdhL | X̗XԗDXȘ H XXTDXDP$XXD$ H(XDTXD X( X@ XXX`XHXXDXDHXTD HXhDDXpD HXpD HXDDXТtD HXDD H | ȣD$ D$ L(4D`DHDЦ4DH(DD,<DPh<DPlLPD H`dD | ĨHDH @D LPDD HtD HD HDD HD | <$ `4dDPD H$ lD ( ,(TD D DH,D D(H$X DP( LDH8DD  |  $DpL\P\DDLDD4D | L,,LXlH LĺD L8L@HLл(DHLD L| LLxHLD L LDD $L$D H(L,LL0D LLpDHL<(DH | d`    , ,  LdLL H <hH$ D$ X8 p\DD( pDH <pDH <H DD D   DH h`DH$ tD$ LH < D L THT T@D LDD HDH (hD D tD H dLDH DH LH LH dhDH DH $ `D$ H0 pD H$ <D$ HP D  pDH l tLD tD H 4( \DH( D `DD |  8DH | 4< 4 44DDX4,dDH4@D H4hD48xDH4lD48D4T,D4pD4D4D H4pD4 DD4,D4 DD4tHL4lTL4D4xD D4PhDD48DD4LDD4<tD | \T  ( 8X  D 0 < P\Ht|H 4 $4tD HlDH DH TDXD H`@DpDHDd\ PXDHX D | @4 tDH $\D$L@  D$lD$ H($XD$ H8$ D$HH $D$Dx $ D$Hx | P(!D$P!D$L8 PH$ P\$$Pp$DD(P&xD$D P) | $()D$ L@ (+ (+($+XDD | |+hD+pDH $T,D$ H88-D$-`D H0T/pD D /D  | |0DH 1DH$2D$H@ | 5(5D$H 7DH | t\8\t8<DLt8\DP tP:ht:$DHt:$Dt;D Ht<LLt<$D$t<D$LH tAPDL | A$DH$A`D$D@ \G`DHG@DD  | Gl hIDD K$DD(( DL(D$D  lNDDDp( ND D D $ TD$ H8 | |X X | HXDH@ZH$H[D$ H0H\DH$H] D$L` $HiD$D@ HTm`DP $HmD$ H0$HnD$L` $H|D$D@ HdXDP HDD | $dD$L@ $HD H0__u_quad_tfuncname_vcm_groupst_ctimsu_shellcm_for__LC_MONETARYunset_bash_inputst_blksizest_blocksr_output_force__jmp_buf_tagglobal_commandarrayind_t_IO_save_endSTRING_INT_ALIST__LC_IDENTIFICATIONexit_immediately_on_erroruidget__gid_tarray_indexedst_mtimr_move_input_word_IO_write_basecm_function_def_lockpath_filenamecommand_typecm_condcurrent_host_nameConnection_IO_save_baser_deblank_reading_until__LC_TELEPHONEArith_chainmap_list_cur_columnarray_assoc__LC_TIMEdump_translatable_strings__dev_tshopt_indexecute_env_filehistory_lines_this_sessionSimpleexecutingeuidpw_dirget_current_user_infocheck_zero_IO_markermake_login_shellcm_connection__s2_lenHASH_TABLEstart_debuggerunbind_argsr_err_and_outsubshell_argcr_instructiondebugging_modedebugging_login_shellselect_compw_shellset_opts__blksize_tcond_com_IO_FILEfuncname_ast_uid__LC_PAPERr_output_directionr_input_directionstepsubshell_argvunsigned charst_rdevfalse_caseREDIRECTEEold_errexit_flagpw_gecosr_duplicating_inputatyperun_shopt_alistarg_startcurrent_command_number__LC_MEASUREMENTarith_for_comCaserunning_under_emacsgroup_com_IO_lock_tsh_var_value_func_tprimary_promptshell_initialize__mode_tnbucketsexit_shellr_move_output_word_IO_read_ptrdynamic_valueshell_reinitializeconnectorassign_funcsamplewant_initial_helpshell_is_restrictedmax_indexFunction_defrun_wordexpstream_typeegid__s1_lentimes_foundnext_arg_markersdebuggingr_move_inputecho_input_at_readstart_indexdefault_inputbash_lineno_aBASH_INPUTtrue_casebash_lineno_v__blkcnt64_tWhileprotected_modeexportstrst_gidshopt_lenforced_interactivewordexp_onlyread_from_stdinr_inputa_directionlongargrun_one_commandlong_argsshell_reinitializedGroupcm_case_flags2cm_untilbucket_contentsarg_end_IO_read_baseGNU C 4.2.4 (Gentoo 4.2.4 p1.0)case_comSHELL_VARsubshell_envp_unused2__quad_tsubshell_environment__mask_was_savedhup_on_exitredirecteest_bstreamst_streamsh_builtin_func_tdump_po_stringssh_exit_old_offsetlocation__LC_NAME__ino_ttop_level_arg_indexlong long intthis_command_nameseconddouble_IO_write_endSubshell__LC_NUMERICrun_by_sshno_rcon_or_offno_profilesh_cget_func_tgnu_error_formatrunning_setuid_IO_buf_baseBUCKET_CONTENTSprivileged_modearg_characterarg_string__pad1__pad2__pad3__pad4__pad5init_interactive_sbufposixly_correct__fdold_errexitcurrent_userWORD_LIST__saved_mask__jmpbuf__jmp_bufst_nlinkinit_noninteractive__st_ino__ino64_tscript_namer_move_outputfstatshort_docinteractive_shellshell_initializedst_devr_duplicating_outputr_reading_stringtimespecsubshell_comsubshell_top_level/root/src/bash-3.2r_duplicating_input_wordcm_arithlong long unsigned intr_appending_tolocally_skip_execution__off_tparse_shell_optionsmaybe_make_restrictedextrashell.cint_valuewhile_comPATTERN_LISTnentriesst_noneact_like_shst_stdinREDIRECTdisable_priv_mode__time_tWORD_DESC_IO_backup_baseSelect_shortbufpw_giddestuser_name__off64_targv0sh_cunget_func_tCOMMANDsourced_loginredirector_IO_buf_endsh_var_assign_func_tpw_uid__resultbash_source_ano_line_editingcm_arith_forstderrshort int__LC_ALLbash_source_vsample_lencm_selectif_com__LC_ADDRESStv_nsechere_doc_eofr_duplicating_output_wordfd_is_tty_vtable_offsetpw_passwdr_reading_untilnum_elementsungetteradd_shopt_to_alist__valrun_startup_filesdo_versionsourced_envstartup_statebashrc_filecm_simplepw_namest_mode__uid_tmalloc_trace_at_exitdefault_buffered_input_IO_read_endkhashparse_long_optionscommand_execution_stringsimple_com_filenocm_subshellsource_fileINPUT_STREAMfunction_trace_moderead_but_dont_executeshow_shell_usageArithFor__LC_MESSAGESshort unsigned intstdoutcm_ifCondset_shell_namewant_pending_commandr_input_outputVAR_CONTEXT_IO_write_ptr__LC_COLLATEopen_shell_scriptarith_comsecondary_promptcm_while__statbuflast_command_exit_value__nlink_tr_close_this__sigset_tshell_start_timetv_secsaverstlong_doc__s1st_atim__LC_CTYPEterminating_signalour_indirection_levelcurrent_commandalrm_catcheratoi__nptrEOF_Reachedparse_commandread_commandsend_pwd_to_etermtmout_varcommand_to_executetmout_lenneed_here_docold_alrmSigHandlervariable_contextexec_donecurrent_command_line_countinterrupt_statereader_loopstdin_redirjust_one_commandfunction_dstartyyacceptlabword_desc_to_readgot_charactereof_encountered_limittimebuflast_read_tokentm_secwas_dollaralias_ttemp_dstackb_flagsaved_line_terminatorcheck_commentexp_linenotoken_to_read_sh_parser_state_tparse_dparenmbclencond_erroryyerrhandleyybackupyylvalcurrent_readline_line_indexprint_offending_linerestore_parser_stateold_echo_inputtm_isdstpop_stringthe_timetoken_before_thattoken_endold_expand_aliasescond_skip_newlinespass_next_character__psCOND_COMorig_input_terminatorinit_yy_ioorig_last_tokenremove_quoted_newlineshell_input_line_propertywith_input_from_stringpushed_string_listy.tab.cprompt_string_pointerold_histnestlentwo_tokens_agotleftcond_oryychar1shell_input_line_sizeword_toppeekcindxetextshell_ungetcorig_line_counterror_token_from_textredir_stackthe_wordSTRING_SAVERspecial_case_tokensyy_readline_ungetexpand_aliasstring_saverb_bufferbash_readline_initializedyyfree_stacksshell_input_line_indexyyerrortemp_promptSTREAM_SAVERbash_input_fd_changedexecute_variable_commandstream_listyyvs1tm_zonesaved_line_indexmbrlentoken_buffer_sizeopen_brace_countcurrent_prompt_stringcond_linenotrightdecode_prompt_stringold_history_expansion_inhibitedyyerrstatusb_usedyypactpromptvarsyynewstateyy_stream_getorig_line_numberpipestatusb_inputpyycheckyytranslate__counttm_houryycharno_semi_successors__wchbslineorig_token_sizegot_tokenb_fdreport_syntax_errorread_a_linecurrent_decoded_promptprint_promptyyerrpopadd_nestretrflagsresult_indexeof_encounteredother_token_alistparse_cond_commandyyreducetoken_is_assignmentyydefgotodist_versionold_sigintrestart_readexpanderword_token_alistterminate_immediatelymk_alexpansioncond_tokenyystateprompt_againcurrent_readline_linelast_lastargfree_string_listshell_input_linepop_streamin_commentsave_dstacktoken_is_identinteractive_commentsvnamepush_stringtm_minassignokcurrent_readline_promptcond_exprold_remember_on_historyparse_compound_assignmentset_current_prompt_leveltm_ydayyydefaultfind_reserved_wordyystacksizepeek_chargather_here_documentsreserved_word_acceptabletm_wdaywith_input_from_streammatched_pair_errorerror_token_from_tokenparse_string_erroryyss1tm_mdayps1_promptyyvalpatch_levelyyssayytableesacs_needed_countyysspBUFFERED_STREAMstream_on_stack__wchfunction_bstartarith_for_linenops2_prompttm_monsaved_line_sizeYYSTYPEreturn_EOFyypgototm_yearlvalueyyr1yyr2__mbstate_tcond_andadddqlast_exit_valuepreviBSTREAMprevsread_token_wordeol_ungetc_lookaheadyyssextended_globttranslentokstryy_string_getyylenyy_readline_getstart_linenoyyvsdelimiter_depthyyerrlab1b_sizehdcshistory_delimiting_charsshell_getctoksymyyabortlaboctal_stringfree_pushed_string_inputword_linenocexpwith_input_from_stdinshell_input_line_terminatorre_read_tokenstream_saverparse_string_to_word_listttranssh_syntaxtabyyerrlabinitialize_bash_input__valueyy_string_ungetsaved_tokenbackq_backslashread_secondary_linettoklenyyerrdefaulttoken_indexresult_sizeretindyynerrsall_digit_tokendiscard_untiltm_gmtoffexpandedyy_ungetcyyvsayy_input_nameyyvspreset_linenoyy_getcreset_parserextended_quotepush_streamyy_stream_ungetparse_matched_pairyylexretsizecmdtypyydefactorig_current_tokenalias_expand_tokenretlenpdollar_presentlast_shell_builtinsigwinch_receivedget_current_prompt_levelhandle_eof_input_unitpass_nextshell_input_line_lenrestore_token_statesave_token_statenot_escapetime_command_acceptabledelimiter_spaceparse_arith_cmdsave_parser_stateyyparseset_line_mbstatesaved_line_ISgraphngroupsbash_tilde_prefixes2legal_identifiertilde_hook_func_t__path_ISspacebash_special_tilde_expansionsget_group_arraybash_tilde_suffixes2_ISalphacheck_identifier_ISdigitsource_uses_pathtty_fdfile_iswdircheck_binary_filetimes_calledmaxfdsame_file_ISblankcheck_dev_ttystring_to_rlimtypebash_getcwd_errstr_ISpunctunquoted_tilde_wordbash_tilde_prefixesbash_tilde_find_wordbash_tilde_suffixesscript_fdgroup_iarraytilde_expansion_preexpansion_hookmove_to_high_fdsh_unset_nodelay_mode__rlim64_told_immedmake_absoluteendptrpolite_directory_formatextract_colon_unithometilde_additional_prefixes_ISalnumnfdsprint_rlimtypecheck_wordtilde_initializetilde_additional_suffixesrlim_tstrtoimaxgroup_memberabsolute_pathnameaddnlbash_tilde_expandsource_searches_cwdstp2base_pathnameassign_plegal_alias_namegeneral.c_IScntrlget_group_list_ISxdigit_ISlower_ISprintposix_initializecheck_newgroup_vectordot_pathfile_isdirall_digitsbflags_ISupperinitialize_group_arraysh_validfdlegal_numbernewipath1path2stp1document_indexmake_pattern_listWHILE_COMCASE_COMcom1com2clean_simple_commandmake_word_flagsmake_word_from_tokenmake_for_or_selectdest_and_filenamemake_function_defmake_cond_commandsh_obj_cache_tconnect_async_listmake_bare_simple_commandcommand_connecttokenizerlstartFUNCTION_DEFARITH_FOR_COMmake_commandIF_COMdocument_sizeobjcacheSIMPLE_COMmake_word_listmake_arith_commandmake_wordCONNECTIONmake_here_documentmake_cond_nodeARITH_COMcmd_initwlcachemake_until_commandmake_until_or_whilensemimake_subshell_commandmake_while_commandstate_bakmake_case_commandmake_group_commandwdcachedelim_unquotedmake_for_commandcommand2make_cmd.credir_lenmblengthSUBSHELL_COMwhichalloc_word_descGROUP_COMmake_redirectionwlinkmake_simple_commandmake_bare_wordmake_select_commandkill_leadingexprsredir_wordmake_arith_for_exprmake_if_commanddocument_donemake_arith_for_commandxprintfthe_printed_command_resizeheredocsgroup_command_nestingprint_arith_commandprint_simple_commandSELECT_COMps4_lenxtflagssemicolonprint_redirection_listredir_fdindirection_stringreset_localsintbuffunc_redirectsnamed_function_stringprint_select_commandmulti_lineindentationdigit_arg__builtin_va_list__gnuc_va_listxtrace_print_case_command_headnewredirprint_cmd.cthe_printed_command_sizextrace_print_for_command_headprint_redirectionxtrace_print_assignmentprint_while_commandcprintfindentation_stringprint_group_commandcmdcopyxtrace_print_arith_cmdprint_cond_nodearg1arg2ps4_firstc_lenps4_firstcprint_case_commandprint_function_defprint_cond_commandarg_lenxtrace_print_word_listxflagsprint_until_commandprint_case_clausescommand_string_indexold_indentindentation_amountnvalhdtailprint_commandxtrace_print_select_command_headindentation_sizeinvertwas_heredocskip_this_indentcommand_print_word_listchar_argmake_command_stringarith_cmd_listxtrace_print_cond_terminside_function_defmake_command_string_internalprint_until_or_whileindirection_level_stringprint_for_commandprint_arith_for_commandthe_printed_commandold_amountpfuncprint_if_commanddispose_commanddispose_function_defmctmpdispose_wordsdispose_word_descdispose_redirectsdispose_cond_nodedispose_cmd.cdispose_function_def_contentsdispose_wordexecute_until_commandnullstrreturn_resultaindilenfildeslast_pidexpoknewddispose_exec_redirectsdispose_fd_bitmapthis_shell_functiontempenv_assign_errortcomru_nsignalsgetinterpeval_arith_for_exprru_isrssexecute_intern_functioncommand_lineru_msgrcvrunning_trapexecute_case_commandlast_command_subst_pidexecute_builtin_or_functionbody_statusexecute_for_commandshell_control_structurerealexecute_cond_commandselfaselfbpatmatchfix_assignment_wordsfunction_line_numberasync_redirect_stdinline_number_for_err_trapshell_fnexec_resultputcharasyncalready_forkedfromshell_execverepl_stringlast_command_exit_signaldup_errorexecute_arith_for_commandendpCOLSpipe_outmkfmttv_useclist_lennew_bitmap_sizeold_flagslast_made_pidprint_index_and_elementexecute_disk_command__suseconds_ttabsizeexecute_cond_nodeafterprecsru_minfltexecute_connectionreplycurrent_fds_to_closeru_utimefuncnesttime_formatclose_pipesru_msgsndrowscmdflagsbreakingexecute_while_or_untilsaved_this_shell_builtindo_pipingsaved_undo_listexecnameshowing_function_lineerror_trace_modecontinuingabufmax_elem_lensfileselectionmy_undo_listarith_linenoignore_returnrusageeval_unwindshould_redir_stdinnoforksubshell_levelexecute_subshell_builtin_or_functionlarrayexec_undo_listsave_linenobind_lastargru_ixrssshow_menuexecute_in_subshellisbltinenvalready_making_childrenexit_case_commandcleanup_redirectsexecute_pipelineparen_pidposix_timematch_ignore_casesindexsetup_async_signalsLINESbuiltin_is_specialdummyfdreturn_catch_valuetz_dsttimeRUSAGE_CHILDRENkidsakidsbwas_error_trapprint_select_listclose_fd_bitmapmflagspipe_inuser_subshell__pid_tlast_asynchronous_pidreturn_valru_nvcswlastwordexecute_command_internalexecute_builtinexecute_cmd.csum_fracRUSAGE_SELFru_idrssparent_returnps3_promptthe_printed_command_except_trapexecute_while_commandinitialize_subshellexec_redirection_undo_listolddreturn_valuewlistru_inblockru_stimeru_nivcswprint_menureleaserecho_command_at_executefdbpbuiltin_statussec_fractionexecuting_line_numberfirst_column_indices_lenexecute_arith_command__rusage_whobeforenew_fd_bitmapfinfoexecute_select_commandfunction_valuesave_currentreturn_codetime_commandfirst_word_quotedexpresultru_nswapfuncvalueselect_queryold_interactivetimezoneexecute_shell_functiondoforkru_oublockru_majfltasynchronousprecold_e_flagexecute_simple_commandexecute_functionru_maxrsssave_line_numbercurrently_executing_commandssizetrap_listexecute_if_commandold_last_async_pidexecute_null_commandprint_formatted_timespecial_builtin_failedother_indices_lentz_minuteswesttempvarsARRAY_ELEMENTvapplybind_variable_internalwinsize_assignedmake_variable_valuerseedpropagate_temp_varpush_scopeITEMLISThome_stringunbind_funcupdate_export_env_inplaceequal_offsetsv_histsizemakunboundhash_lookupmake_vers_arraysearch_tempenvtime_since_startvisible_and_exportedno_invisible_varsfind_functionhflagsbind_functionhistory_write_timestampsbinding_tableget_random_vlistlast_random_valuepop_var_contextsv_opterrdo_supercededollar_dollar_pidsetfunchostname_list_initializedstupidly_hack_special_variablesname_and_functiongetfuncpush_func_varprint_var_valuegroup_setsh_get_env_valueget_random_numbernewvalpush_exported_varvlist_addbind_var_to_intinit_seconds_varenvironset_contextvar_hash_tableadjust_shell_levelisintmake_local_array_variablenew_var_contextmake_funcname_visibleolensv_histtimefmtunusedpop_contextset_home_varfuncdefshell_function_defsdelete_all_variablesvar1var2sh_free_func_tattrsget_linenoexport_env_indexpush_dollar_vars_list_of_itemsset_ppiddollar_arg_stack_indexis_subshellsv_hostfilefind_variablemake_new_array_variableold_leveladd_or_supercede_exported_vardispose_var_contextsv_ifsall_shell_functionscreate_variable_tablessv_sortedget_comp_wordbreakspush_temp_vartptrprint_var_functionhistory_subst_charnull_array_assigndispose_used_env_varsprint_var_listsv_terminalget_selfput_command_name_into_envdispose_variablefree_variable_hash_dataget_subshellkill_all_local_variablespreflenstring_lengthvisible_varuidsetinitialize_dynamic_variablesfind_tempenv_variableinitialize_shell_levelenv_prefixlocal_exported_variablessv_history_controlset_pipestatus_from_exitmake_local_variableget_string_valuehistory_comment_charvariables.cpush_argsget_bash_namen_shell_variablesflattenunbind_variableget_secondssv_localeall_visible_variablestemp_arraydispose_saved_dollar_varstmpvarsvlist_reallocassign_comp_wordbreaksfapplyset_shell_varnew_elttemp_stringlocal_and_exportedperform_hostname_completionmake_env_array_from_var_listassign_subshellget_dirstackprint_func_listvariable_in_contextpush_contextold_varsort_variablestmp_varvar_nameadd_temp_array_to_envaflagsmake_var_export_arrayall_variables_matching_prefixexpanding_redirslistrelease_statusdollar_arg_stackSTRINGLISTnew_vardelete_all_contextsall_visible_functionsfind_special_varbind_tempenv_variablesv_comp_wordbreaksVARLISThistory_lines_in_filesv_pathdollar_arg_stack_slotsall_array_variablesbind_int_variablenew_sizedispose_temporary_envmap_oversv_tzbuild_versionhistory_expansion_charrindforce_tempenvhashed_varsnamebufset_if_notvcontextcdirseconds_value_assignedsbrandset_var_read_onlymerge_temporary_envibufassign_secondsget_funcnamepush_var_contextsh_sv_func_tget_bash_commandisarrnprocchar_indexsv_mailsv_histignoreinitialize_shell_variablesassign_linenosv_ignoreeofsv_strict_posixmap_over_funcsold_SHLVLbash_argv_ash_set_lines_and_columnssv_optindhmaxvindlist_getterbash_argv_vexport_env_sizespecial_varsarray_needs_makingmk_env_stringdo_allocwinsize_assignmentset_machine_varsinit_funcname_varset_pwdvalue_lenbind_variable_valuemake_func_export_arraysv_globignoreget_histcmdnew_shell_variablemake_new_variableassign_in_envwas_tmpvarassign_dirstackprivmodegenlistvisible_array_varssh_opterr_list_of_stringspop_argsinit_dynamic_array_varnew_valuepop_scopeunbind_function_defrl_basic_word_break_characterstcxtassign_randomgenindexget_groupsetqsort_var_compvcxtseeded_subshellglobal_variablesvlist_allocall_exported_variablesvar_lookupsv_histcharspushfsh_var_map_func_tmaybe_make_export_envbash_argc_afind_function_defmark_modified_varsnew_levelbash_argc_vtmp_valuesv_comparesh_get_home_dirset_pipestatus_arrayget_variable_valuefind_variable_internalnew_clausecopy_subshell_commandcopy_arith_commandcopy_wordcopy_case_clausescopy_redirectscopy_arith_for_commandcopy_for_commandnew_fornew_simplenew_redirectnew_defnew_ifcopy_simple_commandcopy_case_clausenew_groupnew_casecopy_word_listnew_whilecopy_redirectcopy_cmd.ccopy_case_commandcopy_function_def_contentsnew_arith_fornew_arithcopy_group_commandnew_condcopy_while_commandnew_commandnew_subshellcopy_if_commandnew_listcopy_cond_commandcopy_function_defnew_wordcopy_commandnew_connectionsys_errorinternal_errorget_name_for_errorprint_linenoprogramming_errorinamecmd_error_tablecommand_errstrerror.cbash_badsub_errmsgcommand_errorreport_errorerr_badarraysuberror_prologerr_readonlyinternal_warningerr_unboundvarthe_current_maintainerparser_errorevalexpexpr_stackvincdecpeektokset_noeval_is_arithopvalidpevalerrorexpshiftcvalunbound_vars_is_errorexpassignexpborsubexprfoundbaselasttpexpr_bind_variablecurtokexplandassigntokexpr_unwindreadtokexppowerexp3expbandexpbxorexplorexp0exp1exp2exp4exp5pushexppopexpexpcommaval1val2expr_streval_is_multiopoevalbuftokvalEXPR_CONTEXTlasttokexpr.cexpr_stack_sizestrlongexpcondexpr_depthsavecpstokfind_flaghashing_enabledplace_keywords_in_envold_valuereset_shell_flagsnoclobberchange_flagasynchronous_notificationbrace_expansiondisallow_filename_globbinghistory_expansionjobs_m_flagflags_alistno_symbolic_linksoptflagsflags.cpipefail_optwhich_set_flagsinitialize_flagschild_maxwait_for_background_pidsalloc_pid_listunfreeze_jobs_listc_cflagc_ospeedproc_statusgive_terminal_tofind_status_by_pidc_iflagwait_signal_receivedshell_ttycleanup_dead_jobsgot_tty_statewait_sigint_handlerc_oflagadd_pidcount_all_jobscc_tj_strsignalpid_list_sizedefault_tty_job_signalstcflag_tretry_forkmark_dead_jobs_as_notifiedreap_dead_jobsmake_childstart_pipelinereap_zombie_childrencheck_window_sizec_linewait_intr_bufpstatusignore_tty_job_signalsretryretcode_name_bufferget_tty_statec_ccfind_proc_slotWAITwait_forgot_pidprocess_exit_statusfind_index_by_pidtermioswait_for_single_pidndeadc_lflagnojobs.cset_pid_statusinitialize_job_controlget_job_by_pidstop_pipelinec_ispeedold_sigint_handlerget_termsigspeed_tdescribe_pidset_tty_staterestore_sigint_handlerwait_sigint_receivedshell_tty_infotop_level_mask__infind_termsig_by_pidtemp_handlerasync_pset_pid_flagskill_pidinitialize_job_signalsstop_making_childrenistring_indexexpand_stringeindexpos_paramsxlistdo_assignmentopen_for_read_in_childskiparithword_splitlist_quote_escapessh_style_splitreplenparameter_brace_expand_wordallow_null_glob_expansionexpand_word_fatalexpand_string_leave_quotedstring_extract_verbatimextract_string_errorquoted_strchrextract_array_assignment_listskip_single_quotedparameter_brace_patsubhad_quoted_nullifs_charsstarsubgetpatspecexpand_words_shellexpchk_arithsubexpand_string_unsplitexpand_string_to_stringgetifsdequote_listsh_wassign_func_ttresultsindifs_firstc_lenfree_retvalid_brace_expansion_wordwparamexpand_word_list_internalnwpatparameter_brace_substringuerrormatch_pattern_charwhitesepexpand_string_assignmentsep_lenget_var_and_typeopenstrexpand_param_errormb_substringarray_length_referencegarglistvar_is_specialparameter_brace_remove_patternsubst_assign_varlistlpatsublen_closerskipcolnumber_of_argsquoted_dollar_athad_quoted_null_psubstrdequote_stringglob_listopencpos_params_pat_substparameter_brace_expand_lengthsentineltemp1patstrbrace_expand_word_listitypeword_lensubst.ctargetexpand_param_fatalseparatorsget_dollar_var_valueassignoffxretwstringprev_ibackquotefinished_with_stringsublenofdspass_characterextract_arithmetic_substmatch_patternzindexmatch_pattern_wcharquoted_dollar_atpexpand_string_if_necessaryvar_is_setmake_dev_fd_filenamevalid_length_expressionvarnameparameter_brace_expandifs_firstcskip_double_quotedchk_atstarparent_pipe_fdquoted_dollar_at_pdo_assignment_no_expandread_comsubexp_jump_to_top_levelarray_remove_patternvar_is_nullchar_is_quotedxifsexpand_string_to_string_internalstrip_trailing_ifs_whitespacewstrlendo_word_assignmentunlink_fifo_listrptrremove_quoted_escapes__ssize_tglob_arraycommand_substitutewant_indirsaw_quoteremove_upatternexpand_string_internalhasdolexpand_wordsstring_list_internalorettotfdsadd_characterexpand_no_split_dollar_staradd_fifo_listexpand_assignment_string_to_stringbufnbufpcurrent_wordtdescword_list_splitindexpnesting_leveltindexunclosed_pairexpand_string_unsplit_to_stringwchar_tpcountlist_rest_of_argsno_longjmp_on_fatal_errorwant_patsubbad_substitutionexpand_arith_stringqdollaratpadd_twocharsadd_quoted_stringold_async_pidstring_quote_removalnewnamede_backslashstring_rest_of_argscheck_nullnessexpand_word_leave_quoteddo_assignment_internalprocess_substitutelen_alt_openerchild_pipe_fdcond_expand_wordappendopstring_list_dollar_atquoted_stateseparate_out_assignmentsrsizeunbound_variablemake_quoted_charwant_substringdisposablessub_append_stringwcharliststring_extract_double_quotedfail_glob_expansioncontains_dollar_atbackqverify_substring_valuessetifsifs_varexpand_wdesc_fatalglob_error_returnlist_stringadd_one_characterlen_openertemp2mbsbakglob_indexgetpatternsendextract_dollar_brace_stringresult_stringnpatget_word_from_stringcurrent_command_subst_pidisexpvtypeold_pipeline_pgrpdollar_add_stringmklocaldo_compound_assignmentvalpexpand_prompt_stringifs_valueold_pidstring_list_dollar_starextract_command_substtemp_listexpand_wdesc_errorEXPFUNCsplit_at_delimsstringpextract_process_substreturn0output_listparam_expanddequote_escapessrcleneflagsparameter_list_remove_patternshell_expand_word_listparameter_brace_expand_indirparameter_brace_expand_rhsifs_cmapparameter_brace_expand_erroristringexpand_word_unsplitextract_delimited_stringhasdollaratonameexpandpatglob_expand_word_listvarpifs_splithas_dollar_atmatch_upatterncall_expand_word_internalstring_extractsaw_escapeextract_string_fatalstripdqorig_lististring_sizematch_wpatternstarterdev_fd_listremove_wpatternexpanded_somethingexpand_string_for_rhsskip_to_delimifs_lenremove_backslashesword_list_remove_quoted_nullserror_exitindicesmbstrlenexpand_words_no_varsexpand_word_errorphash_insertsamephash_removephash_createphash_freedatacheck_dotphash_flushdotted_filenamefull_pathphash_searchhashcmd.chash_bucketnew_buckethash_walkcopy_bucket_arrayhash_disposehashlib.chash_copycpdatahash_stringsh_string_func_thash_wfunchash_sizenew_tablefree_datatime_to_check_maillast_time_mail_checkedremember_mail_datesmail_warningreset_mail_filesFILEINFOatimemailfilesaccess_timemod_timeuse_user_notificationfile_is_biggerparse_mailpath_specmailfilefile_has_grownupdate_mail_fileadd_mail_filecurrent_mail_filemailfiles_countmailpathsfile_mod_date_changedmtimedollar_underscorefree_mail_filesreset_mail_timerfind_mail_filemake_default_mailpathmailcheck.cfile_access_date_changedfile_sizerun_exit_traptrap_to_sighandlersave_return_catch_flagignore_signaltrap.cmaybe_call_trap_handlerset_sigint_handlersignal_nametrap_exit_valueoerrnosh_resetsig_func_treset_signalset_return_traprun_trap_cleanupsignal_in_progresssigmodessave_return_catchrestore_signalreset_signal_handlerssignal_is_ignoredinitialize_traps_run_trap_internalfunction_codedecode_signalold_trapset_signal_ignoredrestore_original_signalsfree_trap_commandchange_signalset_error_trapold_exit_valuesignal_is_specialrun_pending_trapsrun_error_trapsignal_is_trappedtrap_saved_exit_valuerun_interrupt_trapset_debug_traprun_debug_traprestore_default_signalrun_return_trapreset_or_restore_signal_handlersopen_buffered_streamclose_buffered_streambuffered_ungetcharset_buffered_streamlocal_bufusedb_fill_bufferinput.csave_bash_inputduplicate_buffered_streamcopy_buffered_streamcheck_bash_inputsync_buffered_streamfd_is_bash_inputwith_input_from_buffered_streamfd_to_buffered_streamungetc_with_restartset_bash_input_fdbuffered_getcharfree_buffered_streamallocate_buffersbufstream_ungetclocal_indexlocalbufchars_leftnew_fdorig_nbuffersmake_buffered_streamclose_buffered_fdwithout_interruptsold_interrupt_immediatelyclear_unwind_protect_listunwind_protect_mem_internaldesired_settingadd_unwind_protectunwind_frame_discard_internalunwind_frame_run_internalVFunctionunwind_protect_memdiscard_unwind_frameignore1ignore2add_unwind_protect_internalSAVED_VARrestore_variablerun_unwind_protectsclear_unwind_protects_internalrun_unwind_frameuwp_headunwind_prot.cremove_unwind_protectrun_unwind_protects_internalUNWIND_ELTbegin_unwind_frameremove_unwind_protect_internalthis_ignorevalsh_iv_item_func_tignorevarunquoted_glob_pattern_pnoglob_dot_filenamessh_ignore_func_tquote_globbing_charsname_funcnum_ignoresignore_globbed_namesnumitemsnewnamescolon_bitqflagslast_ignorevalshould_ignore_glob_matchesmaxitemssetup_ignore_patternsquote_string_for_globbingshell_glob_filenamepathexp.cglob_name_is_acceptablesetup_glob_ignoresigwinch_sighandlerorig_flagssi_addrsi_errnoprint_newlineset_signal_handlersa_flags__sighandler_tsi_stimesig.ctermsigs_initializedparse_and_execute_levelinitialize_shell_signals_sigchldsigint_sighandlersi_overrunold_winchinitialize_signalssi_sigvalthrow_to_top_levelsigval_tsi_pidsi_utimesi_uidsiginfo_tsival_int__clock_t_pad_sigpoll_sifieldssi_tidtermsig_handler_sigfaulthandling_termsigunset_sigwinch_handlertermsig_sighandlersi_statusorig_handler__sigaction_handlersi_signosiginfosa_sigactionsa_masksa_restorerinitialize_terminating_signalsoactsi_fdreset_terminating_signalssa_handlersival_ptrsi_bandsi_codebinary_operatorinteger_expected_errorbeyondtest.cfilecomparithcompmargcmargvstat_bufunary_operatortwo_argumentsunary_testbinary_testtest_unoptest_exit_buftest_syntax_errortest_commandtest_error_returntest_binopthree_argumentsposixtestpatcompsccs_versionshell_version_stringshow_shell_versionversion.cextendedfree_alias_dataskipquotessh_alias_map_func_talias_expandexpand_this_tokenalias_expand_wordskipwsdelete_all_aliasescommand_wordllenremove_aliasalias_expand_allbackslash_quoted_wordqsort_alias_comparemap_over_aliasesrd_tokenvlenalias.cadd_aliasfind_aliasreal_startsort_aliasesinitialize_aliasesget_alias_valueexpand_nextarray_shiftarray_quotearray_create_elementsh_ae_map_func_tudataarray_disposearray_dispose_elementarray_subrangearray_from_word_listarray_walknelemarray_createarray_removearray_keys_to_word_listarray_copyvalstrarray_to_argvarray_to_word_listarray_to_stringarray.cindstrarray_assign_listarray_unshift_elementarray_shift_elementarray_patsubsifsarray_rshiftarray_to_string_internalarray_insertarray_flusharray_to_assignconvert_var_to_arrayexpand_compound_array_assignmentget_array_valuesubplast_indfind_or_make_array_variableassign_array_elementarray_expand_indexquote_array_assignment_charssaw_eqarray_value_internaldentryarray_variable_partassign_compound_array_listskipsubscriptcheck_flagsvstrarrayfunc.callow_allarray_keysoldvalassign_array_var_from_stringbind_array_var_internalassign_array_from_stringarray_variable_nameiflagsprint_array_assignmentbind_array_variableunbind_array_elementvalid_array_referenceassign_array_var_from_word_listrhs_varray_concatsatisfybrace_arg_separatorarr1arr2lhs_tpartialcommaslen1expand_amblelhs_vrhs_tmkseqlen2postamblestrlen_1brace_gobbleralenbraces.cincrexpand_seqtermpreambleadd_tackrl_ignore_some_completions_functionrl_completion_func_treal_endreally_munge_bracesrl_compignore_func_trl_quote_func_torig_quoting_funcrl_attempted_completion_functionbracecomp.corig_ignore_funcrl_completion_entry_functionstring_gcdorig_attempt_funcsubtermgcd_zeroorig_entry_funcorig_quoting_desiredrl_compentry_func_trl_filename_quoting_desiredrl_filename_quoting_functionhack_braces_completionbash_brace_completionbash_add_historysetup_history_ignorehistory_numbermaybe_append_historycheck_history_controltimestamprl_linebuf_func_thistory_should_ignoreshell_commentshould_expandbash_history_reinithistory_valuelast_history_linehistory_quotes_inhibit_expansionload_historyinteractrl_doneexpand_histignore_patterncurrent_command_first_line_savedmaybe_add_historybash_history_inhibit_expansionaddithist_verifyhist_last_line_pushedcommand_oriented_historycurlenbash_history_enablehistignore_item_funcchars_to_addforce_append_historyhistory_inhibit_expansion_functionpre_process_linehistory_basecheck_add_historyhistory_search_delimiter_charsadd_itHIST_ENTRYliteral_historyhc_erasedupshistdata_trl_dispatching_hist_entrybash_initialize_historyhistory_expansion_pdont_save_function_defsbash_history_disablemaybe_save_shell_historyhistory_reeditingprint_changeshist_last_line_addedlast_history_entryreally_add_historybashhist.cbash_complete_variable_internalKEYMAP_ENTRYrl_dequote_func_trl_filename_dequoting_functionbash_complete_hostname_internalbind_keyseq_to_unix_commandcmd_xmapbash_complete_hostnamebash_execute_unix_commandrl_icppfunc_tmatchnumcompflagsharry_lenclear_hostname_lists_protobash_directory_completion_hookget_hostname_listbash_servicename_completion_functionnew_dirnameorig_funcrl_special_prefixesshell_expand_linebash_dequote_textwhat_to_dotcsh_magic_spacehostname_list_sizeinnerglobtextfoundcsnidxinitialize_hostname_listrl_filename_completion_desiredprog_completion_enabledsearching_pathpath_indexhostname_completion_functionbash_glob_list_expansionshostnames_matchingalias_line_ignore_completion_namesfirst_char_locto_freerl_terminal_namerl_readline_namereturn_zerobash_possible_command_completionsbash_complete_variableedit_command_keymap_entryprog_complete_matchesbash_quote_filenamerl_editing_modeorig_quoting_functionorig_rl_completer_word_break_charactershistory_expand_linebashline_reinitializedisplay_shell_versionbash_completer_word_break_charactersemacs_standard_keymaplocal_dirnamerl_explicit_argsavetialias_listneed_dquotesnarf_hosts_from_fileoperate_and_get_nextrl_completer_quote_charactersisolate_sequencerl_directory_rewrite_hooksaved_history_line_to_usecommand_word_completion_functionrl_markKeymapemacs_ctlx_keymapfilename_completion_ignorerl_completion_suppress_appendnum_shell_builtinsstartpbash_complete_commandttextvi_edit_and_execute_commandin_command_positioncleanup_expansion_errorrl_hook_func_tserventgnamerl_line_buffercclcistateno_empty_command_completionrl_executing_keymapwhereUNDO_BEGINbuild_history_completion_arraybash_complete_username_internalhint_lennmatchrl_completion_append_characterbash_dequote_filenameemacs_meta_keymapnlenshould_expand_dirnameset_saved_historyhint_textgr_memtest_for_directorycommand_subst_completion_functionrl_outstreamhostname_list_lengthdynamic_complete_historyharry_sizeigncasebash_glob_quote_filenamesrventbash_possible_filename_completionsbash_glob_complete_wordUNDO_INSERThistory_max_entriesrl_pointbash_ignore_filenamesquote_charhistory_lengthinitialize_readlineUNDO_DELETEundo_codeafoundvi_movement_keymapgr_passwdfilename_textbash_vi_completebash_directory_completion_matchessnamerl_char_is_quoted_pdequoted_hintbash_ignore_everythingenable_hostname_completionrl_completion_found_quotegnamelenhlistdist_from_endvarlist_indexattempt_shell_completionoidxhistory_completion_generatorquote_word_break_charsrl_endckmaporig_startrl_instreamfind_cmd_startUNDO_ENDxkmapoldnamesat_endvi_insertion_keymaprl_readline_stateposix_edit_macrosorig_dir_funcs_portthis_charinit_unix_command_maphistory_expand_line_internaldtxtpush_to_readlinegrentposix_readline_initializeaentryrl_command_func_trtextgr_namecheck_redirprog_complete_returnmapping_overgloborigsnamelendot_in_pathkstartfirst_charpasscadd_host_nameold_verifyrl_completion_suppress_quotebash_directory_expansionold_pointforce_fignoredequoted_lenvariable_completion_functionstart_lenhistory_and_alias_expand_linefind_cmd_namebashline.crl_attempted_completion_overold_rl_startup_hookbash_nohostname_word_break_charactersbash_complete_filenamebash_possible_username_completionsset_up_new_linecurrent_pathrl_last_funcs_aliaseshint_is_dirbash_glob_expand_wordemacs_edit_and_execute_commandprev_charbash_groupname_completion_functionKEYMAP_ENTRY_ARRAYbash_glob_completion_internalbash_re_editfind_cmd_endbash_complete_filename_internalbash_complete_usernamecmd_indexmtextbash_complete_command_internalincfilebash_specific_completionrl_completion_typegr_gidcommand_separator_charsbash_possible_hostname_completionsrl_directory_completion_hookrl_filename_quote_charactersrl_completion_quote_characterbash_possible_variable_completionsouterbash_default_completionbash_push_linecompletion_quoting_stylefreetempfilename_hintmaybe_make_readline_lineexpanded_stringGENERIC_LISTglobal_error_listt_headlist_reversedo_globstrsubnewlines_onlyglobalfind_token_in_aliststrcreplacefind_index_in_alistrepltemplenstrip_trailingpatlenxbcopystringlib.cfind_string_in_alisttempsizesh_syntabsizset_langset_locale_varfoundnlplc_allfoundnlreset_locale_varslocaletranslocale_setblanksdefault_dirdefault_domaintranslatedset_default_langmk_msgstrset_default_localelocale.clocaleexpandset_default_locale_varsfile_statustemp_pathsearch_for_commandfind_path_filefind_user_commanduser_command_matchesfind_user_command_in_pathfind_absolute_programget_next_path_elementdotinfomatch_list_sizefile_to_lose_onpath_index_pointerhashed_fileis_directoryexecutable_filepath_listmatch_indexxpathdot_found_in_searchcheck_hashed_filenamesexecutable_or_directoryfind_in_path_element_find_user_command_internalfindcmd.cdotinfoptlist1noclobber_openredir_opendocument_lentlist2add_undo_redirectwrite_here_documentredirectee_wordredirection_errorredir_special_openfinfo2stdin_redirectionredir.cdo_redirectionsallocnameredirsdummy_redirectherelenoflagsredirection_expandherestradd_exec_redirectheredoc_errnodo_redirection_internal_redir_special_filenameswrite_here_stringstdin_redirectsclexec_flagalloca_hackhere_document_to_fdadd_undo_close_redirectexpandable_redirection_filenameit_init_joblistit_init_setoptsit_init_builtinscmatchesit_init_runningclean_itemlistunbind_compfunc_variableslwordscompletions_to_stringlistit_init_jobsrl_completion_mark_symlink_dirsbind_comp_wordsinit_itemlist_from_varlistfoundpCOMPSPECit_init_functionsprogrammable_completionsgen_action_completionspcomp_filename_completion_functiongen_compspec_completionsit_init_aliasesfilter_stringlistshouldexp_filterpatit_init_enabledsvfuncit_init_hostnamescmdlenit_init_disabledit_init_stoppedglobpatit_init_variablesit_init_exportedcsbufit_groupsit_exportsgen_globpat_matchesgen_wordlist_matchesrefcountpcomplete.cbuild_arg_listcmdsizefvalpreproc_filterpatgen_matches_from_itemlistit_init_keywordsgen_shell_function_matchesit_usersit_init_shoptsit_commandsset_itemlist_dirtyjstatecompspeccmdlistit_init_signalsgen_command_matchesit_directoriescscmdrmatchestmatchesit_servicesSVFUNCit_init_bindingscommand_line_to_word_listit_filesinitialize_itemlistit_init_arrayvarsntxtfree_progcompprogcomp_flushpcomplib.cprogcomp_searchprogcomp_removecompspec_disposecompspec_copyprogcomp_sizeprogcomp_insertprogcomp_walkprog_completesprogcomp_disposecompspec_createprogcomp_createsyntax.cxmalloc.cxfreexmallocxrealloclbreakbrkfoundfindbrkinitialize_signames./support/signames.carith_docenable_docexit_doccase_docwait_docstatic_shell_builtinscommand_docgrouping_braces_doctrap_doctrue_dockill_docread_doclet_docpushd_doctest_bracket_docfalse_dochistory_doccontinue_doccurrent_builtinpopd_docvariable_help_doccaller_docsource_doccd_docexport_doccolon_docunalias_docwhile_doculimit_doccomplete_docbuiltins.cecho_documask_doccompgen_docdirs_doclocal_docfunction_docconditional_docshift_docarith_for_docselect_docbreak_docdeclare_docdot_docunset_docexec_docpwd_docprintf_docfg_percent_docgetopts_doclogout_doceval_docshopt_docbind_doctimes_doctypeset_doctime_docuntil_dochash_doctest_docreturn_doc/root/src/bash-3.2/builtinsfc_doctype_docbuiltin_docif_docreadonly_docany_failedaflagunalias_builtinpflagprint_aliasloptendfun_namebind.cquery_bindingscmd_seqbind_exitunbind_commandsaved_keymaplist_optargbind_builtinremove_sequnbind_nameinitfilebreak_builtinnewcontbreak.cnewbreakcontinue_builtincheck_loop_levelbuiltin.cbuiltin_builtincaller_builtinsource_slineno_sfuncname_scaller.cverbatim_pwdold_anmnolinksguessnewdirresetpwdndlencdspellbindpwdcallertvarcanon_failedcd.cpwdvarthe_current_working_directorycd_builtinpwd_builtinno_symlinkschange_to_directorycdable_varscdspellingcdpathfalse_builtincolon.ccolon_builtin_CS_POSIX_V6_ILP32_OFFBIG_LINTFLAGS_CS_POSIX_V6_LPBIG_OFFBIG_LDFLAGS_CS_XBS5_ILP32_OFFBIG_CFLAGS_CS_POSIX_V6_LPBIG_OFFBIG_CFLAGScommand.c_CS_POSIX_V6_ILP32_OFF32_LDFLAGS_CS_XBS5_ILP32_OFF32_LINTFLAGS_CS_LFS_LDFLAGS_CS_XBS5_ILP32_OFFBIG_LIBS_CS_XBS5_LPBIG_OFFBIG_LDFLAGS_CS_GNU_LIBPTHREAD_VERSION_CS_XBS5_LPBIG_OFFBIG_LINTFLAGS_CS_XBS5_LP64_OFF64_LIBS_CS_POSIX_V6_LP64_OFF64_LINTFLAGS_CS_LFS_CFLAGS_CS_XBS5_ILP32_OFF32_LDFLAGS_CS_POSIX_V6_ILP32_OFFBIG_LIBS_CS_XBS5_ILP32_OFF32_LIBSuse_standard_path_CS_XBS5_LP64_OFF64_LDFLAGS_CS_POSIX_V6_LPBIG_OFFBIG_LIBSrestore_path_CS_LFS64_CFLAGS_CS_XBS5_ILP32_OFFBIG_LDFLAGS_CS_POSIX_V6_ILP32_OFFBIG_CFLAGS_CS_V6_WIDTH_RESTRICTED_ENVS_CS_POSIX_V6_ILP32_OFF32_LINTFLAGS_CS_XBS5_ILP32_OFF32_CFLAGS_CS_LFS_LIBS_CS_XBS5_LPBIG_OFFBIG_CFLAGS_CS_XBS5_LPBIG_OFFBIG_LIBS_CS_XBS5_LP64_OFF64_LINTFLAGS_CS_LFS64_LDFLAGS_CS_POSIX_V6_LP64_OFF64_LDFLAGS_CS_PATH_CS_LFS64_LINTFLAGS_CS_POSIX_V6_ILP32_OFF32_LIBScommand_builtin_CS_LFS_LINTFLAGSget_standard_pathverboseany_found_CS_XBS5_ILP32_OFFBIG_LINTFLAGS_CS_GNU_LIBC_VERSION_CS_XBS5_LP64_OFF64_CFLAGS_CS_POSIX_V6_LPBIG_OFFBIG_LINTFLAGS_CS_POSIX_V6_ILP32_OFFBIG_LDFLAGS_CS_POSIX_V6_ILP32_OFF32_CFLAGS_CS_LFS64_LIBS_CS_POSIX_V6_LP64_OFF64_CFLAGS_CS_POSIX_V6_LP64_OFF64_LIBSold_pathremember_argsset_dollar_vars_unchangedinitialize_shell_builtinssh_neednumargsh_erangechanged_dollar_varssh_readonlyshell_builtin_comparesh_invalidoptnamebuiltin_addresssbp1sh_invalidnumsh_badpidfind_shell_builtindisplay_signal_listbuiltin_errorsvalmake_builtin_argvsh_invalidoptread_octalget_working_directoryget_numeric_argbuiltin_usagesh_wrerrorsh_notbuiltinbuiltin_address_internalget_exitstatfind_special_builtinset_dollar_vars_changedlsignumno_optionsno_argssh_invalididdestructivesh_restrictedfor_whomsh_needargsh_notfoundcommon.cset_working_directorysh_invalidsigforcecolsdisabled_okaysbp2declare_builtinflags_offtvaluecompound_array_assignsimple_array_assignflags_onmaking_array_specialdeclare.clocal_varsubscript_startlist_opttypedeclare_internallocal_builtinnodefsecho.cxpg_echodo_v9display_returnecho_builtinjust_echodisable_pfilterlist_some_builtinsenable.cenable_shell_commandenable_builtineval_builtinfile_error_and_exitold_return_catch_evalfileerrfuncfnamefc_execute_filesh_vmsg_func_tmaybe_execute_fileforce_noninteractivesflagsevalfile.csourcelevelparse_and_executeevalstring.ccat_fileparse_and_execute_cleanuplast_resultlresetshould_jump_to_top_levelorig_stringexec.cexec_builtincleanenvno_exit_on_failed_execmkdashnameexit.clogout_builtinexit_builtinbash_logoutexit_or_logoutsourced_logoutfc_replhisthistbegfceditnumberingnewcomfc_dosubsfc_gethistlistinglast_histfc.cREPLfc_builtinlcurrentfc_gethnumfc_numberhistendmultiplehash.clist_portablyprint_hashed_commandslist_targetsprint_hash_infoprint_portable_hash_infohash_builtinquietlist_hashed_filename_targetsall_foundexpunge_hash_tableadd_hashed_commandshow_longdocshow_builtin_command_helpsflagblurbhelp.cmatch_foundhelp_builtinpush_historyobasedelete_offsethistory_builtindelete_argdisplay_historyexpand_and_print_historytimestrdelete_histentdelete_last_historyold_history_lineshistory.chisttimesaw_signalany_succeededsigspeckill.cpid_valuecontinue_killingkill_errorkill_builtinlet_builtinlet.cdirectory_list_sizeskipoptcurrent_directoryvflagindex_flagdirs_builtinadd_dirstack_elementpushd_directory_listget_dirstack_indexget_directory_stackpushd_builtinpushd_errorget_dirstack_from_stringchange_to_tempset_dirstack_elementpopd_builtinpushd.cclear_directory_stackdesired_indexcd_to_stringdirectory_list_offsetwhich_wordorig_input_stringold_newline_ctypearraynameinput_is_pipedelim_chartmoutadd_charold_delim_funcold_attempted_completion_functionunbuffered_readreset_eol_delimreset_alarminput_is_ttyold_newline_funcrlbufreset_attempted_completion_functionold_delim_ctypealrmbufsilentrl_num_chars_to_readread_builtinrlindsigalrmhave_timeoutbind_read_variableintvaledit_linereturn_builtinreturn.cinitialize_shell_optionsoption_namevptrlist_minus_o_optsreusableset_ignoreeofset.cset_minus_o_optionno_shelloptsforce_assignmentflag_nameget_minus_o_optsbash_set_historyvsizeset_funcunset_variableget_funcprint_all_shell_variablesreset_shell_optionsparse_shelloptsprint_minus_o_optionget_edit_modeset_posix_modeunset_builtinopts_changedunset_functionisemacsset_edit_modesetopt_set_func_tletterunset_arrayset_shelloptsminus_o_option_valuelist_optoptsetopt_get_func_tset_or_show_attributesarrays_onlyshow_name_attributesexport_builtinreadonly_builtinshow_var_attributespattrset_var_attributevariable_listfunctions_onlysetattr.ctimesshift_builtinshift.cprint_shift_errorsource.csource_builtinmaybe_pop_dollar_varstest_builtintimes_builtinkidstimes.clist_signal_namestrap_builtinoperationfirst_signalfirst_argdisplay_trapsshowtrapfound_filetype_builtinsuccessful_findsdescribe_commandtype.cdescriptionncmd__RLIMIT_RSS__RLIMIT_NLIMITSRLIMIT_DATAcmdargprint_all_limitsunitstrsoftlimvaluep__rlimit_resourceulimit_internalstacklimcurlimlimindfilesizegetmaxvm__RLIMIT_SIGPENDINGRLIMIT_CPUreal_limitulimit.c__RLIMIT_OFILErlim_max__RLIMIT_NPROCRLIMIT_FSIZEcmdlistszoptstring__RLIMIT_LOCKS__RLIMIT_NICEhard_limithardlim_findlim__RLIMIT_MEMLOCKrlimitset_limitpipesize__RLIM_NLIMITS__RLIMIT_RTPRIOULCMDdatalimsoft_limitunitspdescRLIMIT_ASrlim_curulimit_builtinget_limitparameterRLIMIT_COREblock_factorprintoneRLIMIT_NOFILERLIMIT_STACKnewlimRESOURCE_LIMITSgetmaxuprc__RLIMIT_MSGQUEUEinitial_bitsobitsubitsprint_symbolic_umaskprint_symbolicallyumask_builtingbitsumask_valueumask.cpermumask_argparse_symbolic_modewait_builtinwait.cspecial_errordogetoptssh_optoptsh_optindsh_optargsh_badoptgetopts.cstrvalnewindoptstrnumvalgetopts_builtingetopts_bind_variablegetopts_resetold_opterrshopt_set_func_tlist_some_o_optionsset_restricted_shellsave_restrictedshopt.cset_shellopts_after_changeget_shopt_optionsshopt_varsset_shopt_o_optionsset_login_shellfind_shoptglob_ignore_casetoggle_shoptsshopt_errorlist_shoptslist_some_shoptsshopt_login_shelllist_shopt_o_optionsshopt_setoptshopt_builtinshopt_listoptreset_shopt_optionsprint_shoptvbsizeconversion_errormodstartgetchrconvchgetintmaxvblenuintmax_tgetuintmaxgetfloatmaxpadlenconv_bufbexpandprintf_builtinthischmodifierssawcprintf_erangehave_precisionstrtoumaxtescapeconv_bufsizegetintnextchmklongevaluefloatmax_tvbufasciicodeprintstrhave_fieldwidthprintf.cljustvbaddsh_getopt_restore_statesh_curoptnextcharsh_charindexsh_getoptpluslheadbashgetopt.creset_internal_getoptSargprint_all_completionsfind_compoptprint_one_completionactflagWargcompgen_builtinprint_cmd_completionscomplete_builtinGargPargactoptactpprint_compitemoptflagFargXargoptprflagbuild_actionsopt_givencompoptscoptsremove_cmd_completionsCargactnamefind_compact_compactsputenv_getenvlast_tempenv_value/root/src/bash-3.2/lib/shgetenv.crewriteunsetenv_SC_LEVEL3_CACHE_SIZE_SC_INT_MAX_SC_MAPPED_FILES_SC_CHILD_MAX_SC_CLK_TCK_SC_SIGQUEUE_MAX_SC_DEVICE_IO_SC_LEVEL4_CACHE_ASSOC_SC_JOB_CONTROL_SC_CHAR_MAX_SC_TRACE_INHERIT_SC_XOPEN_VERSION_SC_GETGR_R_SIZE_MAX_SC_PII_SOCKET_SC_CHAR_MIN_SC_SAVED_IDS_SC_SCHAR_MAX_SC_ARG_MAX_SC_TIMEOUTS_SC_CHAR_BIT_SC_AIO_LISTIO_MAX_SC_MB_LEN_MAX_SC_THREAD_PRIO_PROTECT_SC_PII_INTERNET_SC_THREAD_PROCESS_SHARED_SC_PII_SC_AIO_PRIO_DELTA_MAX_SC_MEMORY_PROTECTION_SC_OPEN_MAX_SC_THREAD_THREADS_MAX_SC_READER_WRITER_LOCKS_SC_STREAMS_SC_MQ_OPEN_MAX_SC_FIFO_SC_2_C_VERSION_SC_BC_DIM_MAX_SC_THREAD_ATTR_STACKADDR_SC_UINT_MAXgetmaxchild_SC_2_PBS_LOCATE_SC_LEVEL1_DCACHE_LINESIZE_SC_TRACE_EVENT_FILTER_SC_NL_LANGMAX_SC_V6_LP64_OFF64_SC_NL_MSGMAX_SC_PII_OSI_CLTS_SC_LEVEL1_ICACHE_ASSOC_SC_DEVICE_SPECIFIC_R_SC_NZERO_SC_XOPEN_XPG2_SC_XOPEN_XPG3_SC_XOPEN_XPG4_SC_ULONG_MAX_SC_XOPEN_ENH_I18N_SC_INT_MIN_SC_2_UPE_SC_PAGESIZE_SC_FILE_SYSTEM_SC_2_VERSION_SC_RE_DUP_MAX_SC_LEVEL3_CACHE_ASSOC_SC_2_FORT_DEV_SC_IOV_MAX_SC_THREAD_CPUTIME_SC_SYSTEM_DATABASE_SC_PII_INTERNET_DGRAM_SC_FILE_LOCKING_SC_SCHAR_MIN_SC_UIO_MAXIOV_SC_VERSION_SC_SPIN_LOCKS_SC_LEVEL1_DCACHE_SIZE_SC_RAW_SOCKETS_SC_THREADS_SC_THREAD_SAFE_FUNCTIONS_SC_WORD_BIT_SC_REGEXP_SC_ASYNCHRONOUS_IO_SC_CHARCLASS_NAME_MAX_SC_LEVEL1_DCACHE_ASSOC_SC_LEVEL3_CACHE_LINESIZE_SC_THREAD_STACK_MIN_SC_XOPEN_UNIX_SC_NL_TEXTMAX_SC_PII_INTERNET_STREAM_SC_V6_ILP32_OFFBIG_SC_SEMAPHORES_SC_LEVEL4_CACHE_SIZE_SC_MULTI_PROCESS_SC_NPROCESSORS_ONLN_SC_USER_GROUPS_SC_2_LOCALEDEF_SC_LINE_MAX_SC_PHYS_PAGES_SC_XOPEN_REALTIME_SC_SIGNALS_SC_MONOTONIC_CLOCK_SC_RTSIG_MAX_SC_FILE_ATTRIBUTES_SC_USER_GROUPS_R_SC_XOPEN_XCU_VERSION_SC_PII_XTI_SC_XOPEN_REALTIME_THREADS_SC_LONG_BIT_SC_XBS5_ILP32_OFFBIG_SC_UCHAR_MAX_SC_PIPE_SC_TYPED_MEMORY_OBJECTS_SC_LOGIN_NAME_MAX_SC_THREAD_KEYS_MAX_SC_ADVISORY_INFO_SC_COLL_WEIGHTS_MAX_SC_PII_OSI_M_SC_2_C_DEV_SC_SYSTEM_DATABASE_R_SC_USHRT_MAX_SC_IPV6_SC_HOST_NAME_MAX_SC_BC_STRING_MAX_SC_THREAD_PRIORITY_SCHEDULING_SC_2_SW_DEV_SC_REALTIME_SIGNALSoslib.c_SC_XBS5_LPBIG_OFFBIG_SC_2_PBS_ACCOUNTING_SC_THREAD_DESTRUCTOR_ITERATIONS_SC_TRACE_LOG_SC_MEMLOCK_SC_PII_OSI_SC_DELAYTIMER_MAX_SC_2_FORT_RUN_SC_NPROCESSORS_CONF_SC_SHRT_MAX_SC_AIO_MAX_SC_BARRIERS_SC_REGEX_VERSION_SC_LEVEL2_CACHE_LINESIZE_SC_DEVICE_SPECIFIC_SC_SHARED_MEMORY_OBJECTS_SC_XBS5_LP64_OFF64_SC_NL_ARGMAX_SC_SINGLE_PROCESS_SC_AVPHYS_PAGES_SC_XOPEN_SHM_SC_THREAD_SPORADIC_SERVER_SC_NL_NMAX_SC_2_PBS_MESSAGE_SC_SEM_NSEMS_MAX_SC_T_IOV_MAX_SC_PRIORITIZED_IO_SC_V6_ILP32_OFF32_SC_STREAM_MAX_SC_TZNAME_MAX_SC_2_PBS_CHECKPOINT_SC_SPAWN_SC_MEMLOCK_RANGE_SC_BC_SCALE_MAX_SC_SYMLOOP_MAX_SC_2_CHAR_TERM_SC_SHELL_SC_FD_MGMT_SC_XOPEN_CRYPT_SC_LEVEL1_ICACHE_LINESIZE_SC_C_LANG_SUPPORT_R_SC_TIMER_MAX_SC_2_PBS_SC_CPUTIME_SC_SPORADIC_SERVER_SC_CLOCK_SELECTION_SC_XBS5_ILP32_OFF32_SC_NETWORKING_SC_LEVEL4_CACHE_LINESIZE_SC_ATEXIT_MAX_SC_PII_OSI_COTS_SC_MQ_PRIO_MAX_SC_SEM_VALUE_MAX_SC_C_LANG_SUPPORT_SC_TIMERS_SC_PASS_MAX_SC_FSYNC_SC_SELECTgetmaxgroups_SC_TTY_NAME_MAX_SC_POLL_SC_MESSAGE_PASSING_SC_LEVEL2_CACHE_ASSOC_SC_BC_BASE_MAX_SC_LEVEL2_CACHE_SIZE_SC_EXPR_NEST_MAX_SC_SYNCHRONIZED_IO_SC_SHRT_MIN_SC_2_PBS_TRACK_SC_NGROUPS_MAX_SC_V6_LPBIG_OFFBIG_SC_LEVEL1_ICACHE_SIZE_SC_EQUIV_CLASS_MAX_SC_BASE_SC_PRIORITY_SCHEDULING_SC_SSIZE_MAX_SC_GETPW_R_SIZE_MAX_SC_XOPEN_LEGACY_SC_THREAD_PRIO_INHERIT_SC_TRACE_SC_NL_SETMAX_SC_2_C_BIND_SC_THREAD_ATTR_STACKSIZEsh_setlinebufsetlinebuf.clocal_linebufitos.cuinttostruitoslusedzreadczresetnintrzreadzread.czreadintrzsyncfdttattrttgetattrttsetattrttonecharshtty.cttnoechottcbreaktteightbittt_seteightbittt_setnocanontt_setnoechott_setcbreakttoutttnocanonttrestorettsavett_setonecharttsavedfastmap_accuratenot_eolnot_bolrm_eoregs_allocatedsh_regmatchsubexp_indre_nsubreg_syntax_tno_subregex_tregexsubexp_lenshmatch.csyntaxregmatch_tnewline_anchorcan_be_nullre_pattern_buffersubexp_strfastmapregoff_trm_soamatchrematcheaccess.csh_statsh_eaccesspath_is_devfdsh_stataccess__socklen_tsa_familynetconn.cisnetconnsa_datasa_family_tsockaddrai_addrlen_netopenhost_netopen6servaddrinfoai_socktypeai_addrSOCK_DGRAMai_familySOCK_RDMai_nextgerrSOCK_SEQPACKETSOCK_PACKET__socket_typeSOCK_RAWai_canonnameai_flagsSOCK_STREAMres0netopen.chintsai_protocoladdtimevalseconds_fractionprint_timevaltimeval_to_secsminutestimeval_to_cpudifftimevaltimeval.csh_makepathdirlenxdirpathlenmakepath.c_path_isdirdotdotstub_chardouble_slash_pathrootedpathcanon.csh_canonpathbufsizresolved_path_readlinksh_realpathlinklenqsaveworkpathsh_physpathpathphys.cqbaselinkbuf_PC_ALLOC_SIZE_MIN_PC_ASYNC_IO_PC_NAME_MAX_PC_PATH_MAXtmpfile.c_PC_PIPE_BUF_PC_MAX_CANON_PC_VDISABLE_PC_REC_MIN_XFER_SIZE_PC_REC_MAX_XFER_SIZEfilenum_PC_CHOWN_RESTRICTEDntmpfiles_PC_SYNC_IOget_tmpdirget_sys_tmpdir_PC_SYMLINK_MAXtmpnamelenlroot_PC_FILESIZEBITStdlen_PC_SOCK_MAXBUF_PC_REC_INCR_XFER_SIZE_PC_NO_TRUNC_PC_2_SYMLINKSsh_mktmpfdnamepnamerootsh_mktmpnamesh_mktmpfp_PC_REC_XFER_ALIGN_PC_MAX_INPUT_PC_LINK_MAX_PC_PRIO_IOstrlist_to_word_liststrlist_flushstrlist_createstrlist_mergesh_strlist_map_func_tstrlist_printstrlist_disposestrlist_prefix_suffixstrlist_sortstrlist_removestarting_indexstrlist_walkstrlist_from_word_liststrlist_appendstrlist_resizestrlist_copystringlist.cstrvec_copystrvec_flushstringvec.cstrvec_resizestrvec_disposestrvec_createstrvec_sortstrvec_from_word_liststrvec_removestrvec_to_word_liststrvec_lenstrvec_strcmp__dirstreamdirentspell.cd_reclend_inomindistd_offbestspnamespdistoldnamesh_mkdoublequotedsh_backslash_quote_for_double_quotessh_single_quotesh_un_double_quoteshquote.csh_backslash_quotesh_double_quotesh_contains_shell_metastoupper__resansic_quoteansic_shouldquoteansiexpandstrtrans.cansicstrst_retst_new_lastmailstatmailstat.cst_ret_lastst_tmpfmtulong.cfmtulongfmtumaxfmtumax.cxstrchr.cstrlengthxstrchrzcatfdzcatfd.cws_ypixelwinsize.cfrom_sigws_colws_xpixelws_rowget_new_window_sizepathbufdotlistrootdevdotpdotspathpmount_pointnamlenrootinodotinodotdevthisinolose2pathsizesaved_errnothisdevgetcwd.cdotsizegetcwdzwrite.czwriterl_pre_input_hookrlstaterl_visible_prompt_lengthrl_save_state_rl_term_autowrapreadline_internal_setupnpromptreadline_internal_teardownreadline_internal_charloopreservedcatchsigwinchrl_restore_statereadline_initialize_everythingrl_redisplay_function_rl_output_meta_charslastfuncrl_initializedrl_initializeUNDO_LISTrl_pending_inputedmoderl_numeric_argrl_catch_signalsreadline.c__rl_keyseq_context_rl_subseq_getchargot_subseq_rl_out_streamlastcreadline_internal_char_rl_subseq_resultoldmap_rl_keyseq_chain_disposeocxtchildval_rl_init_line_staterl_insert_mode_rl_mark_modified_lines_rl_screenwidthrl_library_versionokeybind_arrow_keysxkeymap_rl_comment_begin_rl_bell_preferencerl_prep_term_functionrl_key_sequence_lengthrl_line_buffer_len/root/src/bash-3.2/lib/readline_rl_meta_flagrl_erase_empty_linenkeyrl_already_promptedoutfrl_vintfunc_tpendingin_rl_set_the_linerl_deprep_term_function_rl_dispatching_keymap_rl_enable_metareadline_top_levelnewkeyrl_gnu_readline_prl_undo_listbind_arrow_keys_internalbuflen_rl_internal_char_cleanuprl_executing_macrocatchsigs_rl_last_command_was_kill_rl_in_streamreadline_default_bindingsreadline_internalsubseq_retval_rl_keyseq_cxt_disposereadline_echoing_prl_promptinsmode_rl_keyseq_cxt_alloc_rl_dispatchwhat_rl_eof_char_rl_keymapsubseq_arg_rl_convert_meta_chars_to_ascii_rl_bind_stty_chars_rl_parsing_conditionalized_out_rl_kscxt_rl_horizontal_scroll_moderl_display_prompt_rl_dispatch_callbackrl_set_promptrl_voidfunc_t_rl_want_redisplaykseqlenrl_readline_versioneof_foundrl_arg_sign_rl_screenchars_rl_dispatch_subseq_rl_keyseq_cxt_rl_screenheightrl_catch_sigwinchrl_vi_bWord_rl_vi_callback_change_charvi_replace_map_rl_callback_datarl_vi_redo_rl_vi_change_mbchar_case_rl_vi_callback_char_search_rl_vi_change_char_rl_vi_callback_set_markvi_mark_charsrl_vi_ewordrl_vi_tilde_expandrl_vi_back_to_indent_rl_vi_callback_getcharrl_vi_fetch_historyrl_vi_overstrike_delete_rl_vi_set_markrl_vi_start_inserting_rl_vi_done_insertingwanted_rl_cs_dirrl_vi_columnrl_vi_arg_digitrl_vi_eWord_rl_vi_initialize_line_rl_vi_goto_markrl_vi_next_wordopointrl_vi_overstrikevi_continued_commandrl_vi_matchrl_vi_subst__rl_callback_generic_argvi_redoingrl_vi_fwordold_endrl_vi_movement_moderl_vi_prev_word_rl_cs_orig_dirrl_vi_yank_argrl_vi_put_rl_vi_set_lastnextkey_rl_vi_doing_insert_rl_callback_funcrl_vi_domove_rl_vi_last_search_mblenrl_vi_eof_mayberl_vi_insert_beg_rl_vi_last_search_mbchar_rl_vi_backuprl_byte_oriented_rl_vi_last_arg_sign_rl_undo_group_levelrl_vi_change_case_rl_vi_callback_goto_mark_rl_vi_textmod_commandrl_vi_yank_torl_vi_undo_rl_vi_append_forward_rl_vi_last_replacementrl_vi_delete_tovi_insert_buffer_size_rl_vi_stuff_insertrl_vi_change_to_rl_vi_save_insert_rl_vi_last_key_before_insert_rl_vi_arg_dispatchvi_mode.c_rl_vi_last_repeatrl_vi_completevi_textmod_rl_vi_last_motionrl_vi_search_againstart_posrl_vi_searchrl_vi_bwordvi_motionrl_vi_deleterl_vi_replacerl_vi_fWordvi_replace_count_rl_vi_reset_lastrl_vi_first_printrl_vi_bracktype_rl_vi_last_commandrl_vi_ruboutrl_vi_checkbrackrl_digit_loop1rl_vi_append_mode_rl_callback_func_trl_vi_end_wordrl_vi_append_eolrl_vi_insertion_moderl_vi_char_searchvi_insert_bufferlast_is_identfunmap.crl_initialize_funmapFUNMAPfunmap_program_specific_entry_startrl_funmap_namesrl_add_funmap_entryfunmap_initializeddefault_funmapfunmap_sizerl_copy_keymaprl_make_keymaprl_make_bare_keymapkeymaps.cnewmaprl_discard_keymapallocated_linesearch_string_sizerl_history_search_backwardhindexrl_noninc_reverse_search_againpcharrl_history_search_pos_rl_nsearch_dosearchsline_lenprev_line_foundrl_noninc_forward_searchhistory_string_sizehistory_search_stringrl_history_search_reinit_rl_nsearch_cleanup_rl_search_cxt__rl_search_contextnoninc_dosearchsline_indexnoninc_history_pos_rl_nsearch_abortsave_pointsave_markrl_history_search_forwardnoninc_search_stringrl_noninc_forward_search_again_rl_saved_line_for_historynoninc_search_from_poslast_found_lineoldposrl_history_search_internalrl_history_search_len_rl_nsearch_dispatchsave_undo_listmake_history_line_current_rl_nscxtnoninc_searchsearch_string_indexrl_noninc_reverse_search_rl_nsearch_callback_rl_nsearch_initt_stopset_winsizesigint_blockedblock_sigint_rl_last_tty_charssave_tty_charsoldtiorl_deprep_terminalt_eol2_rl_restore_tty_signalsrl_tty_unset_default_bindings_get_tty_settings_rl_bind_tty_special_charst_quitotiorl_stop_outputt_weraseioctl_retrelease_sigintt_suspsigint_set_set_tty_settingst_reprintt_killrltty.crltty_set_default_bindings_rl_enable_keypadterminal_preppedtty_sigs_disabled_rl_tty_charsnosigsttyt_dsusprl_prep_terminalt_eof_rl_disable_tty_signalst_lnext_RL_TTY_CHARSprepare_terminal_settingst_intrsigint_osetrl_tty_set_default_bindingsrl_restart_outputt_erasettybuffset_special_char_rl_complete_show_allrl_complete_with_tilde_expansiondtextlowest_commontemp_string_indexusers_dirnameget_y_or_n_rl_completion_case_foldinsert_all_matchesrl_inhibit_completiondead_slotrl_insert_completionsgen_completion_matchesappend_to_matchrl_visible_statsrl_display_match_listrl_username_completion_function_rl_complete_show_unmodifiedrl_menu_completeextension_char_rl_print_completions_horizontallyprint_filenamerl_completion_modecompletion_changed_bufferrl_completenewlenremove_duplicate_matches_rl_complete_mark_symlink_dirs_rl_free_match_listinsert_matchnontrivial_lcd_rl_find_completion_wordrl_completion_query_itemsinvoking_keysaved_line_bufferdo_replacematchespfnwidthorig_textprintable_partour_func_rl_vis_botlinnontrivial_matchshould_quotecompute_lcd_of_matchesrl_completion_display_matches_hookrl_cpvfunc_tps_backset_completion_defaultsdisplay_matchesto_printrl_completion_word_break_hookrl_filename_completion_functionstat_charrl_ignore_completion_duplicatesrl_complete_internalnew_full_pathnamerl_completion_matchesrl_compdisp_func_trl_possible_completionsorig_endmake_quoted_replacementprinted_lenrl_basic_quote_characters_rl_match_hidden_filespostprocess_matchesfilename_lenfnprinttemp_matches_rl_internal_pager_rl_page_completionsisbrkmatching_filenamesrl_display_fixedbrkchars_rl_complete_mark_directoriesrl_quote_filenamematch_list_indexfor_pagercfuncrl_list_funmap_namesuseq_rl_read_init_fileprint_readablymacro_keysold_line_numberparser_endifsizeprl_variable_valueprefix_len_rl_sv_func_t_rl_prefer_visible_bellrl_blink_matching_parenif_stack_depthdefault_funccurrent_readline_init_linenorl_dump_macrosrl_macro_dumperrl_unbind_keyrl_add_defunlast_readline_init_fileparser_elseif_stackrl_bind_key_if_unbound_in_maprl_parse_and_bindopenname_rl_macro_dumper_internalrl_bind_key_if_unbound_rl_init_file_errorrl_unbind_function_in_mapnumbufrl_invoking_keyseqs_in_mapfind_boolean_varassoc_listrl_bind_key_in_map_rl_possible_control_prefixesrl_dump_functionsrl_unbind_key_in_maprl_variable_dumperrl_get_keymaprl_get_keymap_name_from_edit_modebool_to_int_rl_get_keynamehandle_parser_directiverl_bind_keyrl_dump_variablesfunnamestring_varlistrl_get_keymap_name_rl_untranslate_macro_value_rl_history_preserve_pointrl_bind_keyseq_in_mapif_stack_sizerl_variable_bindescmapsv_combeginsv_keymapkeymap_names_rl_possible_meta_prefixesequivalency_rl_get_string_variable_valuerl_set_keymaprl_function_dumpersv_bell_styleparser_ifrl_binding_keymaprl_re_read_init_filestatementknameinvokersglean_key_from_name_rl_isearch_terminatorsold_init_filerl_bind_keyseqrl_invoking_keyseqsrl_unbind_command_in_mapcurrently_reading_init_filesv_compquery_rl_parser_func_tparser_directivessv_isrchtermsubstring_member_of_arrayparser_includerl_bind_keyseq_if_unboundrl_translate_keyseqcurrent_readline_init_filerl_get_keymap_by_namerl_generic_bindrl_bind_keyseq_if_unbound_in_maprl_named_functionrl_function_of_keyseqrl_set_keyrl_untranslate_keyseqmacro_keys_lenhack_special_boolean_varcurrent_readline_init_include_levelsv_editmoderl_set_keymap_from_edit_modeold_include_levelrl_macro_bindboolean_varlistfind_string_var_rl_read_filename_key_alist_rl_isearch_callbackrl_search_historylast_isearch_string_rl_isearch_initisearch.c_rl_isearch_cleanupsearchlen_rl_scxt_dispose_rl_scxt_allocmsglenreverse_p_rl_iscxt_rl_search_getcharrl_forward_search_historydefault_isearch_terminatorslast_isearch_string_lenrl_reverse_search_history_rl_isearch_dispatch_rl_isearch_finirl_display_searchwstartwsatendinvflsetndisp_rl_erase_at_end_of_linemodmarkinvfl_rl_update_finalminsize_rl_strip_prompttempwidth_rl_term_clrpagsaved_invis_chars_first_lineps_oldrl_expand_promptntempredraw_promptsaved_local_promptvisible_first_line_len_rl_terminal_can_insert_rl_current_display_linesaved_prefix_lengthfull_linesinsert_some_charsigstartrl_forced_update_displaychanged_screen_linevtemp_rl_term_DCrl_character_lenoldp_rl_term_crrl_restore_promptwofflb_linenum_rl_term_dcdelete_charsinit_line_structuresninvis_rl_last_c_poscpos_buffer_position_rl_term_eicpos_adjusted_rl_term_clreolvisible_wrap_offset_rl_move_vert_rl_move_cursor_relativesaved_last_invisible_rl_last_v_pos_rl_term_ICcol_tempspace_to_eol_rl_redisplay_after_sigwinchnew_offsetsaved_visible_lengthlast_lmargin_rl_make_prompt_for_searchsaved_local_prefix_rl_term_ic_rl_term_imlb_botlinmsg_saved_promptnewoutpindrl_clear_messageprompt_physical_chars_rl_erase_entire_linerl_show_charphys_c_poscurrent_lineprompt_last_lineomaxrl_message_rl_term_forward_charvis_lbreaksmsg_bufwc_widthprompt_last_screen_lineprompt_this_linesaved_physical_chars_rl_clear_to_eolps_newvis_lbsizewc_bytesprompt_prefix_lengthignoringlocal_prompt_lenrl_save_promptdeltaforced_displayniflplocal_prompt_prefixupdate_linereal_screenwidthprompt_invis_chars_first_linesaved_local_lengthinv_botlin_rl_wrapped_multicolumn_rl_suppress_redisplay_rl_clean_up_for_exitphyscharspmtlenprompt_sizecol_lendifflpromptcursor_linenumrl_on_new_line_with_promptrl_redisplay_rl_term_upnmaxnleft_rl_clear_screen_rl_col_widthprompt_last_invisiblecurrent_invis_charsitemprl_on_new_linelposinvisible_lineo_cpos_rl_wrapped_linerl_reset_line_statedisplay.cprompt_visible_lengthinv_lbreaksinv_lbsizesigmask_setrl_sigwinch_handlerrl_set_sighandlerrl_cleanup_after_signalrl_clear_signalsold_termrl_maybe_set_sighandlerdummyold_tstpohandlerbsetold_handlerrl_set_signalsrl_signal_handlersignals.crl_reset_after_signalold_intsigwinch_set_flagold_ttouold_ttinsighandler_cxtsignals_set_flagold_quitrl_free_line_state_rl_qsort_string_comparerl_extend_line_buffer_rl_pure_alphabeticrl_abort_rl_digit_p_rl_walphabetic_rl_uppercase_p_rl_allow_pathname_alphabetic_chars_rl_to_lowerhomedirrl_tilde_expand_rl_strindex_rl_lowercase_prl_copy_text_rl_savestringrl_tty_statusrl_alphabetic_rl_abort_internal_rl_to_upper_rl_digit_valuecount_passedundo_neededrl_unix_word_rubout_rl_copy_word_as_killrl_backward_kill_wordrl_unix_filename_ruboutrl_copy_forward_wordregion_kill_internalrl_kill_regionrl_yank_nth_arg_internalrl_kill_linerl_unix_line_discardhistory_skiprl_kill_full_linerl_yank_poprl_yankrl_kill_ring_lengthrl_set_retained_killsrl_kill_indexrl_max_killsrl_kill_wordrl_yank_last_argrl_kill_ringrl_copy_region_to_kill_rl_copy_to_kill_ringrl_yank_nth_argorig_pointrl_kill_textrl_backward_kill_lineexplicit_arg_prl_copy_backward_wordnpoint_rl_doing_an_undowaiting_for_beginrl_revert_lineroving_rl_fix_last_undo_of_typerl_do_undorl_undo_command_rl_copy_undo_listundo.crl_add_undorelease_rl_copy_undo_entryrl_begin_undo_grouprl_modifyingalloc_undo_entryrl_free_undo_listrl_end_undo_groupcurrent_macro_indexcurrent_macro_sizerl_end_kbd_macrorl_call_last_kbd_macro_rl_next_macro_keycurrent_macro_rl_pop_executing_macromacro_listrl_start_kbd_macroexecuting_macro_indexmacro.c_rl_push_executing_macrorl_push_macro_input_rl_kill_kbd_macrosaved_macro_rl_with_macro_input_rl_add_macro_charpop_indexchars_avail_rl_insert_typeinrl_gather_tyirl_read_key_rl_read_mbchar_rl_pushed_input_available_rl_input_availablefd_setold_timeoutibuffer__arrrl_get_charpush_indexfds_bitsrl_getc_func_treadfdsexceptfds_rl_unget_charibuffer_spacerl_set_keyboard_input_timeoutrl_getcrl_stuff_charrl_clear_pending_input__fd_mask_rl_input_queuedmb_lenrl_execute_next_rl_any_typeinrl_event_hookrl_getc_functionmbchar_bytes_length_rl_read_mbstringibuffer_len_rl_callback_data_alloc_rl_arg_cxtcallback.cin_handler_rl_callback_data_disposerl_callback_handler_removerl_vcpfunc_trl_callback_read_char_rl_argcxtrl_callback_handler_installrl_linefuncjcodeolevel_rl_callback_newlinetcap_initialized_rl_set_screen_size_rl_term_at7_rl_term_vsterm_has_meta_tc_string_rl_init_terminal_io_rl_term_backspacetgetent_retterm_buffer_rl_term_goto_rl_term_pcget_term_capabilities_rl_enable_meta_keyrl_reset_terminal_rl_output_some_charsterm_string_buffer_rl_term_ip_rl_term_kD_rl_term_kI_rl_visible_bell_rl_control_keypad_rl_term_verl_dingtc_var_rl_term_kH_rl_backspace_rl_get_screen_size_rl_term_kd_rl_term_ke_rl_term_kh_rl_term_kl_rl_term_kr_rl_term_ks_rl_term_kurl_crlfrl_prefer_env_winsizeignore_envbind_termcap_arrow_keysrl_resize_terminal_rl_output_character_function_rl_set_cursorrl_get_termcap_rl_term_mm_rl_term_motc_valuetc_stringsterminal.crl_reset_screen_sizerl_arrow_keysrl_backward_word_rl_overwrite_charinword_rl_char_search_callbackrl_transpose_wordsrl_transpose_charsxpointrl_insertrl_forward_wordw2_end_rl_insert_charfdirrl_insert_comment_rl_char_search_rl_history_saved_pointpending_bytes_lengthrl_backward_charrl_forward_charrl_rubout_rl_insert_next_callback_rl_char_search_internalsmbcharword1mbkey_rl_overwrite_ruboutrl_insert_textrl_tab_insertrl_delete_textrl_downcase_worddecreaserrl_capitalize_wordclear_undorl_comment_len_rl_fix_pointincoming_lengthrl_set_markw2_begrl_delete_horizontal_spaceincomingrl_deleterl_forward_rl_rubout_charrl_rubout_or_deletecurr_linerl_end_of_linefix_mark_toorl_replace_linerl_refresh_linebdirw1_endtext.crl_delete_or_show_completions_rl_insert_nextprev_pointrl_beg_of_linerl_do_lowercase_versionpreposrl_upcase_word_rl_set_mark_at_posrl_backward_byterl_forward_bytestored_countrl_change_caserl_comment_textpending_bytesw1_begrl_quoted_insert_rl_replace_textrl_exchange_point_and_markrl_newlinerl_backwardword2char_lengthrl_backward_char_searchlend_rl_init_eightbitlspec_rl_get_locale_varnls.crl_maybe_save_line_rl_arg_init_rl_start_using_history_rl_set_insert_modemisc.crl_overwrite_moderl_end_of_historyrl_vi_editing_mode_rl_arg_overflowrl_digit_looprl_discard_argument_rl_free_saved_history_linerl_replace_from_historyrl_get_next_historyrl_maybe_unsave_linerl_get_previous_history_rl_arg_dispatch_rl_history_set_point_rl_arg_getcharrl_maybe_replace_linerl_digit_argumentrl_beginning_of_history_rl_arg_callback_rl_free_history_entryold_temp_rl_reset_argumentrl_universal_argumentrl_emacs_editing_modeadd_history_timemax_input_historyunstifle_historyhistory_get_history_statecopy_history_entryhistory_set_history_state_hist_statereplace_history_datahistory_is_stifledreplace_history_entryhistory_offsethistory_total_byteshistory_stifledhistory_listhistory_get_timeremove_historywhere_historyhistory_sizeHISTORY_STATEhist_inittimecurrent_historyalloc_history_entrythe_historyclear_historyatolhistory_gethistory_set_posexpecting_word_specsubst_rhs_lenhistexpand.clenptrhistory_arg_extracterror_pointersubstitute_globallysubst_lhswant_quoteshistory_expand_internalcaller_indexhistory_tokenizequoted_search_delimiterhistory_tokenize_internalhistory_find_worderrtypesearch_matchpeekindphstringget_history_eventget_history_word_specifieriptrhistory_tokenize_word_hist_search_func_thistory_no_expand_charshist_string_extract_single_quotedresult_lennew_eventsubst_bywordsonly_printingdelimiting_quoteget_subst_patternsubst_lhs_lenhistory_substringhistory_word_delimiterspostproc_subst_rhsret_stringsubstring_okayfake_ifake_squote_breaksprint_onlyhist_errorend_index_ptrhistory_expandemsgis_rhssearch_funchistory_filenameread_history_rangehistfile.cchars_readbufendnelementshome_lenhistory_do_writehistory_truncate_filewrite_historyoverwritelast_tsline_starttruncate_exitoverflow_errnoline_endread_historyhistsearch.chistory_search_prefixanchoredhistory_searchnon_zero_prevfind_non_zero_rl_is_mbchar_matched_rl_char_value_rl_find_next_mbchar_internalmbutil.c_rl_find_next_mbchar_rl_find_prev_mbchar_rl_compare_chars_rl_find_prev_mbchar_internalpos1pos2_rl_adjust_point_rl_get_char_lenbuf1buf2tilde_find_prefixuser_entrydefault_suffixesglue_prefix_and_suffixisolate_tilde_prefixtilde_find_suffix./tilde.ctilde_expand_worduser_lentilde_expansion_failure_hookdefault_prefixessuffindrl_set_paren_blink_timeoutfind_matching_openrl_insert_close_rl_enable_paren_matching_paren_blink_usecreadymatch_pointparens.coutfuntcenvterm_entrytputstermcap.cstr1str2name_matchindirectnlinesscan_filetermcap_namespeedsmemory_outateofesctabmalloc_sizetgetnumtgetst1tgetflag/root/src/bash-3.2/lib/termcapnreadgobble_linecompare_continfulltgetstrtgetentpadcountappend_endtputs_baud_ratefind_capabilityfilepareaold_argpoutendtparam1arg0tparamtparam.coutstringtgoto_buftgotodoleftvposdouptwodigitarg3hposonedigitordinaryoutlenpat_wcdirectory_lennextnamewdequote_pathnamedn_wcmemory_errornextlinklastlinkpat_ndn_nglob_dir_to_arrayglob.corig_wpathnamembskipnametmplinkinternal_glob_wpattern_pname_vectorglobvalfree_dirnametemp_resultsinternal_glob_pattern_p/root/src/bash-3.2/lib/globudequote_pathnameadd_slashglob_vectornallocafirstmallocdirectory_nameglob_testdirbopenstrmatch.cwcsmatchpatscan_wcwscomparecendpnestbrackmatch_wcnewnccnamewant_wordCC_NO_CLASSCC_CNTRLbrcntCC_DIGITCC_SPACEcclass_namestrcomparesrestmbslengthsavepposix_collsymsCC_WORDccharCC_PUNCTCC_XDIGITCC_PRINTcstartpatscanequivCC_GRAPHCC_ASCIIprestpnextCC_ALPHAparse_collsymrangecmp_wc__collsymxstrmatchCC_ALNUM__collwcsymCC_BLANKpsubCC_UPPERextmatch_wcinternal_strmatchposix_collwcsymsbfirstis_cclasswint_tsmatch.cchar_classgmatch_wccollequiv_wcis_wcclasswctobextmatchinternal_wstrmatchCC_LOWER__wcwctype_tlflagsparse_collwcsymbnestbrackmatchpsbufxdupmbstowcsxmbsrtowcs.cwstmpwsbufwcnumlocal_statewsbuf_sizeindicespdestpidxtmplocal_state_usexmbsrtowcswclengthpstate]}$]$}0PPXP]}}]}] }PP $]$} (P0TPX`PhlPPP T ]}t}tx]x} tPUtQY8XT$P]} P}PX]X}P\P\`S`pP]}} PpP<DpLpPRPPP$,P0@P<DUU<LU<DVV<LV<DTTPT<LTL`PhQ<DWW<LW]}T }PT tT X ]X \ }\ }T d Pd U 4 Ux  U@ p U V T V T V  V @ T@ L VX V T T U T  V  TL X Vp U x Z Z Z ` T T T\ x T@ L Tt Q QX \ Q P( 0 P P ( P  P0 < P x W W L WX W ` T T T ( T0 \ T@ L T ] } ] } } PP Q X R V S Z W P W]} 8$}P } <W<V}4V4|}|LVLW}V}WVP}PV}VX}X V \ }\ V } V 0!}0!d!Vd!!}!!V!!}!!V!L"}L"`"V`"#}#@#W@#X#VX##}##W#8$}Q8$}R8$} TdhTTPTTxTh TPPP ##Px4}4V|}}} \ V 0!Vd!!V!!V!L"V`"#}X##}##V##}#8$} |UU \ U 0!Ud!!U!!U!L"U`"#UX##U#8$U@tP t 8$t@pP p 8$pt|lll \ l 0!ld!!l!!l!L"l`"#lX##l#8$l U $P$U@PU Uh|T TLTT@TT T0tX|XLXXXXPXXX X !X!L"X`"8$X0TLTT##T8TPTRPR\P PLXRX`P R P#$#P$#(#R0#4#PPRlLXpXXXPX X #X@##X#8$XQ!!Q` U|LUpUU4UUPU U\ U U!!UL"`"U ##U@#X#UlLWpWWWPW W #W@##W#8$WlLZpZZZPZ Z #Z@##Z#8$Z hTTP PdPPP P P $!P!!P!!PH"L"Pd U4UU0!d!U!!U ##UdTdT0!d!T ##T] } ,}P,0]0<} <}TPRP]$}$`} DTPPLW`WTHV`V`d]dl} lh} |TTT(,],4}4H}HpPSPPP(P,\P`PSS $SP]4}4<]<\} \}]} 4}48]8@}@L}4DPDLWLP]PX}X}]}PV(PTXP]} }PW P W $ ]$ }d P ] }  } P  W Q  V R R  R S  T  ] } H } 0 P , Q, 8 SH L ]L P }P x }H ` PH \ Q\ h Sx | ]| } } \ ] } P T  P R D PH ` Ph | P P P ]  } ]  }$  }8` t Xt T X T  Xl x P P  P R  R  ] $ }$$ }( ( P( W 4 Q4 U 4 R4 V ] } x} P PUXU04U`|VTV PTTVT<V<xTx|]|}$}!}!xP U VUUVU V 0U08V8@U@TVTUVUVUVUVUVHUHLVLUV U (V(lUltVtUVUVUV$U$LVLtUt|V|dUdtVtUU R$PTT|R XRPPT|RPS(S8DSHTPVqLsLqPsPrPsrPs8P8rsrXWWWYYDTT T48TPTTdTPT T HPTTT(LTXpPptQTP(T<DTDtPTTT0LTxTP\tTtPYPSPSPSPS$(P(8ST$T$LPLT@PTxPPP]}]}$P$}(PP$[|\U8UL U !"U"P$U0dPTTP8Pt T !$!Tt!|!P!!P!!P!!P!"T""P4"8"P8"X"TX"h"P""TdPP TP P Pt!|!P!!P!!P!!P""P "4"PX"h"P##P $!T""T|\Z8ZLP$Z""P"$#P,#`#Px##P##PP$T$]T$X$}$X$.}P$$P%%PP$x$Qx$.[P$x$Rx$.DP$x$Sx$.@P$x$x$.$%H%.H$%U% &P &|,U|,,Q,.U$%L%.L$%P%.P$$T$%T%.T$%X%.X$%p%.p$%l%.l$%\%.\$%Z%.Z$%`%)`))P).`%%T%%T(\)T++T-d-T.(.T$$T$%V%%T%%V%%T%%V%h&Th&p&Rp&|&V|&@'T@'X'VX''T')V)\)T\))V)8*T8*D*VD*+T++V+,T,d-Vd--T--V--T-(.V(.P.TP.`.V`..T$%W%.W$$d$%d%.d..]..} .$0}0..P.$0Y..Q.H/Tx//T/$0T./P/L/Ux/$0U..W..P.$0W@//V//P/$0V0//t/$0t$0(0](080}$80P2}($0L0PL0P2Y01V2P2V01U2P2U01Z11Z2P2ZP2T2]T22}22]22}$2hU}22P22P22P4N8NP22X2$3X$343P43>X?@X@L@PL@PDXDFXF GP G,GX,G@GP@GLJXLJhJPhJJX,K|LXLLX(MMXMNPPNRXR(SX8ShUX22W24W57W9:W?p@WADDWDDWdEEWEDFW,GHWLJhJW,KKW(M0MWNNWNNPNNWhOOWOOPOxRW8SSWThUW22U23UD44U57U47L8U89U9:U;<<U>8>U??U@BUCdDUDDUPEdEUxEEUEFUFFUG GU,GHUDHPHULJhJUKKU|LLUL0MUXMhMUMMUMMU,NPNUNNUNNUhOOUOPUP PUPPUPPU`P|PUPPUQQUQQURRU(S8SUSSUS`TUlTTUTTUTTUTTUThUUBCUdExEU,KKUP0PU22[25[55T59[99T9x;[x;;S;;T;<[<<R<<T<I[IJSJ JU JJSJ(JU(J8JR8J|L[LL[(M4N[PN0O[0O8OS8OW?p@WADDWDDWdEDFW GHWLJJW,KKWXL|LWLLW(M0MWNNWhOOWP|PW22T23TH4 5T586U86D6TD66U67T47p7Tp7L8U88P89U9:T::U::P:;U;<T =<=T<=D=PD=,>U,>8>T8>H>UH>h>Th>>P>?U??U?T@TAAT@B$CTlC0DTDDTxEETEEUEFT GPHTPH|HPLJhJT K,KU,KKTXL|LULLU(M,MU,MMTPNNTNNTLOOTPXPThP|PT22T23TH4 5T 5\5V\55U586V86D6TD67V747U47d7Td77V7L8U89Ux99U99P99U9:V:8:T8:;V;<T<=V=>T>,>U,>H>VH>h>Th>>V??P?\?U??V?T@TAAT@B$CTlC0DTDDTxEETEEUEEVEFT G,GV,GPHTdILJVLJhJThJJUJJU,KKTK,LVXL|LVLLV(M0MV0MMTPNNTNNT0OLOVLOOTPXPThP|PT22U44U57U47L8U89U9:U;<=U>8>U@?\?T\?p?Up??T??UEFU G,GUJJTJJTJ KU(M0MU22l29l99S9<l<=S=ElEESE|LlLLl(M4NlPNRlR(Sl8ShUl22h2l?hl?p?Pp?|LhLLh(M4NhPNRhR(Sh8ShUh22\LP|P\22T23TH4 5T57T47p7T98:T;<TH>h>T?T@TAAT@B$CTlC0DTDDTDdETxEETEFT,GPHTLJhJT,KKT0MMTPNNTNNTLOOTPXPThP|PTS`TTTTT22T23TH4 5T57T47p7TD89T98:T;<TH>h>T?T@TAAT@B$CTlC0DTDDTxEETEFT,GHTLJhJT,KKT0MMTPNNTNNTLOOTPXPThP|PT22V47VT89V9@;V;<V<=>V,>>V??VEEVEEV G,GVPHHVXLxLVLLV(M0MV22W23WH44W57WP89W9:W?p@WADDWDDWdEEWEDFW,GHWPHHWLJhJW,KKWNNWhOOWP|PW22T23TH4 5T57T47p7T7D8T89T 99T98:T;<T>,>TH>h>T?T@TAAT@B$CTlC0DTDDTxEETEFT,GPHTLJJT,KKT(MMTPNNTNNTLOOTPXPThP|PT44U57U47L8U8x9U9:U;<<U>8>U??UEFU22X546X>?XJ,KX(M0MX22T23TH4 5T57T47p7T98:T;<TH>h>T?T@T@AT@B$CTlC0DTDDTxEETEFT,GPHTLJhJT,KKT0MMTPNNTNNTLOOTPXPThP|PTTTT22V2H3VH47V89V9@;V;<V<=>V,>>V??V0B0DVtDDVdEEVEEV GHVLJhJV,KKVXLxLVLLV(M0MVNNVhOOVP0PV22W23WH44W57W9:W?p@WADWdEEWEDFW,GHWLJhJW,KKWNNWhOOWP|PW22T23TH4 5T57T47p7T98:T;<TH>h>T?T@TAAT0B$CTlC0DTXDDTxEETEFT,GPHTLJhJT,KKT0MMTPNNTNNTLOOTPXPThP|PT23UH44U57U47L8U89U9:U;<<U>8>U??U0BBUdDDUEFU,GGULJhJUKKUNNUhOOUCCP,K4KP22T23TH4 5T57T47p7T98:T;<TH>h>T?T@TAAT@B$CTlC0DTDDTxEETEFT,GPHTHITIpIUpIhJT,KXLT0MMTPNNTNOTPXPThP|PTxRRTR(SUHHPHHP IIP,LTLPNOPxRRPHdIV,LXLVN0OVxRRVR(SVH@JZKXLZN@OZxRRZR(SZ22Y24Y57Y9:Y?EYE GY,GPHYHhJY,KXLY(M4NYPNRYR(SY8ShUY22H2|LHLLH(M4NHPNRHR(SH8ShUHKKPKKPKKP22VM0MVRRV(S8SV22P(M0MPPPPPPRTTP22pPPpSSpTTpTTPhUlU]lUU}UU]UU}UZ} }8<=P=0>l<=Q=0>U<<R<0>h<<S<0>X<==0>W<==0>V<==0>Z<= =0>TX==p=0>p>>Ph==P==P==P==P0>8>]8>L>}$L>dJ}0>d>Pd>BVB$CVCXDVlFHGV|GGVGGVXHlHV0>d>Qd>PDWTEGWGGWXHlHWHHW|IdJW0>d>Rd>dDXEGXGIX|IdJX0>d>Sd>`D[EG[GI[|IdJ[0>t?t?x?x?|?P|?????BBBBCCCCEEEPElFlFFFFFFFdJ@BYBCYClFYFdJY@@Q@@S@@Q@@S@@QBBUCCUTE FUGGUHHUABPCCPDDlFPGHGP|GXHPlHHPH|IPIdJP>CZCdJZL@BTCCTClFTGHGT|GHTH|ITIdJT?BXBCXClFXFFXFdJX>C\CdJ\P@BUBBUCTEUGHGU|GGUGHUH|IUT@B`CC`ClF`GHG`|GH`H|I`IdJ`?D@TBCTFFTFGT?@PFFPFFQFFPABdCCdTElFdGGdHHdIdJdBBVCCVTElFVGGVHHVIdJVB$Bl$B,BPHBBlCClTElFlGGlHHlIdJlBBhdEPFhPF\FPGGhHHhHHPIdJhIIQBBTCCTTEFTGGTHHT FlFUIdJUBBV$CCVHG|GVHHV|IIVBBT\G|GTHHT|IITBBWPDTEWGGWGXHWlHHWH|IWHDTDPBBTlDTETGGTGXHTlHHTI|ITdJhJ]hJpJ}pJJ} dJtJPtJJVdJ|JQ|JJUJJ]JJ}J\N}8J0KP0KDMTpMMTMNTNNPN\NTJJQJ>TBBUB0CT|CCUCCUCCUDDTDDUDDTDDUD ET E0EU4;@;V@;h;Uh;<V@AUAAVABUBhBVBBV>P>>P>>P@AT$BhBTBBTB CP0C4CPXD\DPdDlDPDDP EEPE EPlEGT<=TCCTDDT<@=WBBWdCCWCCW EU0CX?T\??TDXDT>>P$?,?PD$DP$D(DR,DDDPDDHDRLDXDP??P??P??P??P@$@P,@L@P`@t@P@@PDDP4?\@U<<UhBBULC|CUCCUCCUxDDUDDU0ETEUG G] GG}GG}0G$GP$GGZ$G0GQ|GGQ$G0Gp};;P;P>W;;Q;P>D<0<P<<P<<P=<=P=>U>>P>$>U$>(>P;t=U$>(>U8>P>U<l<T<D=TD=\=Z\=8>T<0<Q<<Q<<R<<Q=<=Q<\=T8>P>T<|<[<@>[\=|=P==P(>0>PP>T>]T>\>}$\>?}P>t>Pt>?WP>t>Qt>?YP>t>Rt>?`??Tl?p?U??U??U>>P?T?Pp??P??P??P??P??Q??]??} ?8C}(??P?BZ C8CZ??Q?T@UA@AUAAU@@WAAW4BBW8@AYA8CY@@@X@AXABX C8CX@AWAAWA4BWB8CW,@0@P0@AVAdAPdAAVA4BV4B8BP8BxBVxBBPB8CVD@AUxAAUA4BUTBxBUB8CU@ATAATA4BTBBTB CT C8CTD@Aq||AAq|A4Bq|TBxBq|B8Cq|@ @P@@P$@(@Q@AZAAZB4BZB CZ@AxAU4BTBUxBBU8C